| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 26585 |
Name | GREM1 |
Synonym | C15DUPq|CKTSF1B1|CRAC1|CRCS4|DAND2|DRM|DUP15q|GREMLIN|HMPS|HMPS1|IHG-2|MPSH|PIG2;gremlin 1, DAN family BMP antagonist;GREM1;gremlin 1, DAN family BMP antagonist |
Definition | DAN domain family member 2|cell proliferation-inducing gene 2 protein|colorectal adenoma and carcinoma 1|cysteine knot superfamily 1, BMP antagonist 1|down-regulated in Mos-transformed cells protein|gremlin 1, cysteine knot superfamily, homolog|gremlin 1- |
Position | 15q13.3 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 8037 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | BMP receptor signaling;PID Curated;200123 |
Disease | Embryoma;FunDO |
Disease | Diabetes mellitus;FunDO |
Disease | nonsyndromic cleft lip with or without cleft palate;GAD |
Disease | Basal cell carcinoma;FunDO |
Disease | Kidney disease;FunDO |
Disease | DEVELOPMENTAL;GAD |
Disease | Hypertension, Pulmonary;FunDO |
|
External Links |
|
Links to Entrez Gene | 26585 |
Links to all GeneRIF Items | 26585 |
Links to iHOP | 26585 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>26585 : length: 345 atgagccgcacagcctacacggtgggagccctgcatgtgacggagcgcaaatacctgaag cgagactggtgcaaaacccagccgcttaagcagaccatccacgaggaaggctgcaacagt cgcaccatcatcaaccgcttctgttacggccagtgcaactctttctacatccccaggcac atccggaaggaggaaggttcctttcagtcctgctccttctgcaagcccaagaaattcact accatgatggtcacactcaactgccctgaactacagccacctaccaagaagaagagagtc acacgtgtgaagcagtgtcgttgcatatccatcgatttggattaa |
Protein Sequence |
>26585 : length: 114 MSRTAYTVGALHVTERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYGQCNSFYIPRH IRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD |