| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 27086 |
Name | FOXP1 |
Synonym | 12CC4|HSPC215|MFH|QRF1|hFKH1B;forkhead box P1;FOXP1;forkhead box P1 |
Definition | fork head-related protein like B|forkhead box protein P1|glutamine-rich factor 1|mac-1-regulated forkhead |
Position | 3p14.1 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 7353 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 27086 |
Links to all GeneRIF Items | 27086 |
Links to iHOP | 27086 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>27086 : length: 345 atgatgcaagaatctgggactgagacaaaaagtaacggttcagccatccagaatgggtcg ggcggcagcaaccacttactagagtgcggcggtcttcgggaggggcggtccaacggagag acgccggccgtggacatcggggcagctgacctcgcccacgcccagcagcagcagcaacag tggcatctcataaaccatcagccctctaggagtcccagcagttggcttaagagactaatt tcaagcccttgggagttggaagtcctgcaggtccccttgtggggagcagttgctgagacg aagatgagtggacctgtgtgtcagcctaacccttccccattttga |
Protein Sequence |
>27086 : length: 114 MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQ WHLINHQPSRSPSSWLKRLISSPWELEVLQVPLWGAVAETKMSGPVCQPNPSPF |