| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 29108 |
Name | PYCARD |
Synonym | ASC|CARD5|TMS|TMS-1|TMS1;PYD and CARD domain containing;PYCARD;PYD and CARD domain containing |
Definition | apoptosis-associated speck-like protein containing a CARD|caspase recruitment domain-containing protein 5|target of methylation-induced silencing 1 |
Position | 16p11.2 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 829 |
TUSON P-value | 0.03046082 |
|
Pathways and Diseases |
|
Pathway | NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621 |
Pathway | Direct p53 effectors;PID Curated;200101 |
Pathway | Cytosolic DNA-sensing pathway;KEGG PATHWAY;hsa04623 |
Disease | Cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 29108 |
Links to all GeneRIF Items | 29108 |
Links to iHOP | 29108 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>29108 : length: 588 atggggcgcgcgcgcgacgccatcctggatgcgctggagaacctgaccgccgaggagctc aagaagttcaagctgaagctgctgtcggtgccgctgcgcgagggctacgggcgcatcccg cggggcgcgctgctgtccatggacgccttggacctcaccgacaagctggtcagcttctac ctggagacctacggcgccgagctcaccgctaacgtgctgcgcgacatgggcctgcaggag atggccgggcagctgcaggcggccacgcaccagggctctggagccgcgccagctgggatc caggcccctcctcagtcggcagccaagccaggcctgcactttatagaccagcaccgggct gcgcttatcgcgagggtcacaaacgttgagtggctgctggatgctctgtacgggaaggtc ctgacggatgagcagtaccaggcagtgcgggccgagcccaccaacccaagcaagatgcgg aagctcttcagtttcacaccagcctggaactggacctgcaaggacttgctcctccaggcc ctaagggagtcccagtcctacctggtggaggacctggagcggagctga |
Protein Sequence |
>29108 : length: 195 MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFY LETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRA ALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQA LRESQSYLVEDLERS |