| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 3094 |
Name | HINT1 |
Synonym | HINT|NMAN|PKCI-1|PRKCNH1;histidine triad nucleotide binding protein 1;HINT1;histidine triad nucleotide binding protein 1 |
Definition | adenosine 5'-monophosphoramidase|histidine triad nucleotide-binding protein 1|protein kinase C inhibitor 1|protein kinase C-interacting protein 1 |
Position | 5q31.2 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 8364 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 3094 |
Links to all GeneRIF Items | 3094 |
Links to iHOP | 3094 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>3094 : length: 381 atggcagatgagattgccaaggctcaggtcgctcggcctggtggcgacacgatctttggg aagatcatccgcaaggaaataccagccaaaatcatttttgaggatgaccggtgccttgct ttccatgacatttcccctcaagcaccaacacattttctggtgatacccaagaaacatata tcccagatttctgtggcagaagatgatgatgaaagtcttcttggacacttaatgattgtt ggcaagaaatgtgctgctgatctgggcctgaataagggttatcgaatggtggtgaatgaa ggttcagatggtggacagtctgtctatcacgttcatctccatgttcttggaggtcggcaa atgcattggcctcctggttaa |
Protein Sequence |
>3094 : length: 126 MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHI SQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQ MHWPPG |