| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 378708 |
Name | APITD1 |
Synonym | CENP-S|CENPS|FAAP16|MHF1;apoptosis-inducing, TAF9-like domain 1;APITD1;apoptosis-inducing, TAF9-like domain 1 |
Definition | FANCM-interacting histone fold protein 1|Fanconi anemia-associated polypeptide of 16 kDa|apoptosis-inducing TAF9-like domain-containing protein 1|centromere protein S |
Position | 1p36.22 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 2895 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | Cell Cycle, Mitotic;Reactome;REACT:152 |
Pathway | DNA Replication;Reactome;REACT:383 |
Disease | Congenital abnormality;FunDO |
Disease | Neuroblastoma;FunDO |
Disease | Intraocular melanoma;FunDO |
|
External Links |
|
Links to Entrez Gene | 378708 |
Links to all GeneRIF Items | 378708 |
Links to iHOP | 378708 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>378708 : length: 417 atggaggaggaggcggagaccgaggagcagcagcgattctcttaccaacagaggctaaag gcagcagttcactatactgtgggttgtctttgcgaggaagttgcattggacaaagagatg cagttcagcaaacagaccattgcggccatttcggagctgactttccgacagtgtgaaaat tttgccaaagaccttgaaatgtttgcaagacatgcgaaaagaaccacaattaacactgaa gatgtgaagctcttagccaggaggagtaattcactgctaaaatacatcacagacaaaagt gaagagattgctcagattaacctagaacgaaaagcacagaagaaaaagaagtcagaggat ggaagcaaaaattcaaggcagccagcagaggctggagtggtggaaagtgagaattaa |
Protein Sequence |
>378708 : length: 138 MEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCEN FAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQINLERKAQKKKKSED GSKNSRQPAEAGVVESEN |