| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 3814 |
Name | KISS1 |
Synonym | HH13|KiSS-1;KiSS-1 metastasis-suppressor;KISS1;KiSS-1 metastasis-suppressor |
Definition | kisspeptin-1|malignant melanoma metastasis-suppressor|metastasis-suppressor KiSS-1|metastin|prepro-kisspeptin |
Position | 1q32 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 9440 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | Signaling by GPCR;Reactome;REACT:14797 |
Pathway | Peptide ligand-binding receptors;PID Reactome;500405 |
Disease | Cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 3814 |
Links to all GeneRIF Items | 3814 |
Links to iHOP | 3814 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>3814 : length: 417 atgaactcactggtttcttggcagctactgcttttcctctgtgccacccactttggggag ccattagaaaaggtggcctctgtggggaattctagacccacaggccagcagctagaatcc ctgggcctcctggcccccggggagcagagcctgccgtgcaccgagaggaagccagctgct actgccaggctgagccgtcgggggacctcgctgtccccgccccccgagagctccgggagc ccccagcagccgggcctgtccgccccccacagccgccagatccccgcaccccagggcgcg gtgctggtgcagcgggagaaggacctgccgaactacaactggaactccttcggcctgcgc ttcggcaagcgggaggcggcaccagggaaccacggcagaagcgctgggcggggctga |
Protein Sequence |
>3814 : length: 138 MNSLVSWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTERKPAA TARLSRRGTSLSPPPESSGSPQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLR FGKREAAPGNHGRSAGRG |