| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 4118 |
Name | MAL |
Synonym | -;mal, T-cell differentiation protein;MAL;mal, T-cell differentiation protein |
Definition | T-lymphocyte maturation-associated protein|myelin and lymphocyte protein |
Position | 2q11.1 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 10245 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | role of mal in rho-mediated activation of srf;PID BioCarta;100114 |
Disease | Adenoma;FunDO |
Disease | Esophagus cancer;FunDO |
Disease | Rheumatoid arthritis;FunDO |
Disease | Prostate cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 4118 |
Links to all GeneRIF Items | 4118 |
Links to iHOP | 4118 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>4118 : length: 462 atggcccccgcagcggcgacggggggcagcaccctgcccagtggcttctcggtcttcacc accttgcccgacttgctcttcatctttgagtttatcttcgggggcctggtgtggatcctg gtggcctcctccctggtgccctggcccctggtccagggctgggtgatgttcgtgtctgtg ttctgcttcgtggccaccaccaccttgatcatcctgtacataattggagcccacggtgga gagacttcctgggtcaccttggacgcagcctaccactgcaccgctgccctcttttacctc agcgcctcagtcctggaggccctggccaccatcacgatgcaagacggcttcacctacagg cactaccatgaaaacattgctgccgtggtgttctcctacatagccactctgctctacgtg gtccatgcggtgttctctttaatcagatggaagtcttcataa |
Protein Sequence |
>4118 : length: 153 MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSV FCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYR HYHENIAAVVFSYIATLLYVVHAVFSLIRWKSS |