| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 4826 |
Name | NNAT |
Synonym | Peg5;neuronatin;NNAT;neuronatin |
Definition | - |
Position | 20q11.2-q12 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 1914 |
TUSON P-value | 0.312066661 |
|
External Links |
|
Links to Entrez Gene | 4826 |
Links to all GeneRIF Items | 4826 |
Links to iHOP | 4826 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>4826 : length: 246 atggcggcagtggcggcggcctcggctgaactgctcatcatcggctggtacatcttccgc gtgctgctgcaggtgttcctggaatgctgcatttactgggtaggattcgcttttcgaaat cctccagggacacagcccattgcgagaagtgaggtgttcaggtactccctgcagaagctg gcatacacggtgtcgcggaccgggcggcaggtgttgggggagcgcaggcagcgagccccc aactga |
Protein Sequence |
>4826 : length: 81 MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKL AYTVSRTGRQVLGERRQRAPN |