| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 4830 |
Name | NME1 |
Synonym | AWD|GAAD|NB|NBS|NDKA|NDPK-A|NDPKA|NM23|NM23-H1;NME/NM23 nucleoside diphosphate kinase 1;NME1;NME/NM23 nucleoside diphosphate kinase 1 |
Definition | NDP kinase A|granzyme A-activated DNase|metastasis inhibition factor nm23|non-metastatic cells 1, protein (NM23A) expressed in|nucleoside diphosphate kinase A|tumor metastatic process-associated protein |
Position | 17q21.3 |
Gene Type | protein-coding |
TSG scores | Description |
| TUSON ranking | 11431 |
TUSON P-value | 1 |
Pathways and Diseases | |
Pathway | Metabolism of nucleotides;Reactome;REACT:1698 |
Pathway | Regulation of RAC1 activity;PID Curated;200165 |
Pathway | Arf6 downstream pathway;PID Curated;200079 |
Pathway | salvage pathways of pyrimidine ribonucleotides;BioCyc;PWY0-163 |
Pathway | De novo pyrimidine deoxyribonucleotide biosynthesis;PANTHER;P02739 |
Pathway | pyrimidine deoxyribonucleotides de novo biosynthesis;BioCyc;PWY0-166 |
Pathway | Arf6 trafficking events;PID Curated;200046 |
Pathway | pyrimidine ribonucleotides de novo biosynthesis;BioCyc;PWY0-162 |
Pathway | Metabolic pathways;KEGG PATHWAY;hsa01100 |
Pathway | Purine metabolism;KEGG PATHWAY;hsa00230 |
Pathway | Pyrimidine metabolism;KEGG PATHWAY;hsa00240 |
Pathway | Regulation of CDC42 activity;PID Curated;200059 |
Pathway | granzyme a mediated apoptosis pathway;PID BioCarta;100035 |
Pathway | E-cadherin signaling in the nascent adherens junction;PID Curated;200105 |
Pathway | endocytotic role of ndk phosphins and dynamin;PID BioCarta;100099 |
Pathway | Validated targets of C-MYC transcriptional activation;PID Curated;200045 |
Pathway | De novo pyrimidine ribonucleotides biosythesis;PANTHER;P02740 |
Pathway | pyrimidine ribonucleotides interconversion;BioCyc;PWY-5687 |
Pathway | De novo purine biosynthesis;PANTHER;P02738 |
Disease | CANCER;GAD |
Disease | Neuroblastoma;OMIM |
Disease | lymph node involvement and other histopathological indicators of high metastatic potential;GAD |
Disease | colorectal cancer;GAD |
External Links | |
Links to Entrez Gene | 4830 |
Links to all GeneRIF Items | 4830 |
Links to iHOP | 4830 |
Sequence Information | The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence | >4830 : length: 459 atggccaactgtgagcgtaccttcattgcgatcaaaccagatggggtccagcggggtctt gtgggagagattatcaagcgttttgagcagaaaggattccgccttgttggtctgaaattc atgcaagcttccgaagatcttctcaaggaacactacgttgacctgaaggaccgtccattc tttgccggcctggtgaaatacatgcactcagggccggtagttgccatggtctgggagggg ctgaatgtggtgaagacgggccgagtcatgctcggggagaccaaccctgcagactccaag cctgggaccatccgtggagacttctgcatacaagttggcaggaacattatacatggcagt gattctgtggagagtgcagagaaggagatcggcttgtggtttcaccctgaggaactggta gattacacgagctgtgctcagaactggatctatgaatga |
Protein Sequence | >4830 : length: 152 MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPF FAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS DSVESAEKEIGLWFHPEELVDYTSCAQNWIYE |