General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information |
|
---|---|
Gene ID | 51237 |
Name | MZB1 |
Synonym | MEDA-7|PACAP|pERp1;marginal zone B and B1 cell-specific protein;MZB1;marginal zone B and B1 cell-specific protein |
Definition | HSPC190|caspase-2 binding protein|marginal zone B- and B1-cell-specific protein|mesenteric estrogen-dependent adipose 7|mesenteric oestrogen-dependent adipose gene- 7|plasma cell-induced ER protein 1|plasma cell-induced resident ER protein|plasma cell-ind |
Position | 5q31.2 |
Gene Type | protein-coding |
TSG scores |
Description |
TUSON ranking | 11077 |
TUSON P-value | 1 |
External Links |
|
Links to Entrez Gene | 51237 |
Links to all GeneRIF Items | 51237 |
Links to iHOP | 51237 |
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>51237 : length: 570 atgaggctgtcactgccactgctgctgctgctgctgggagcctgggccatcccagggggc ctcggggacagggcgccactcacagccacagccccacaactggatgatgaggagatgtac tcagcccacatgcccgctcacctgcgctgtgatgcctgcagagctgtggcttaccagatg tggcaaaatctggcaaaggcagagaccaaacttcatacctcaaactctggggggcggcgg gagctgagcgagttggtctacacggatgtcctggaccggagctgctcccggaactggcag gactacggagttcgagaagtggaccaagtgaaacgtctcacaggcccaggacttagcgag gggccagagccaagcatcagcgtgatggtcacagggggcccctggcctaccaggctctcc aggacatgtttgcactacttgggggagtttggagaagaccagatctatgaagcccaccaa caaggccgaggggctctggaggcattgctatgtgggggaccccagggggcctgctcagag aaggtgtcagccacaagagaagagctctag |
Protein Sequence |
>51237 : length: 189 MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQM WQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSE GPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSE KVSATREEL |