| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 55450 |
Name | CAMK2N1 |
Synonym | PRO1489;calcium/calmodulin-dependent protein kinase II inhibitor 1;CAMK2N1;calcium/calmodulin-dependent protein kinase II inhibitor 1 |
Definition | CaMKIINalpha|caMKII inhibitory protein alpha|caMKIIN-alpha |
Position | 1p36.12 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 4204 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 55450 |
Links to all GeneRIF Items | 55450 |
Links to iHOP | 55450 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>55450 : length: 237 atgtcggaggtgctgccctacggcgacgagaagctgagcccctacggcgacggcggcgac gtgggccagatcttctcctgccgcctgcaggacaccaacaacttcttcggcgccgggcag aacaagcggccgcccaagctgggccagatcggccggagcaagcgggttgttattgaagat gataggattgatgacgtgctgaaaaatatgaccgacaaggcacctcctggtgtctaa |
Protein Sequence |
>55450 : length: 78 MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIED DRIDDVLKNMTDKAPPGV |