| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 5920 |
Name | RARRES3 |
Synonym | HRASLS4|HRSL4|PLA1/2-3|RIG1|TIG3;retinoic acid receptor responder (tazarotene induced) 3;RARRES3;retinoic acid receptor responder (tazarotene induced) 3 |
Definition | HRAS-like suppressor 4|RAR-responsive protein TIG3|retinoic acid receptor responder protein 3|retinoic acid-inducible gene 1|retinoid-inducible gene 1 protein|tazarotene-induced gene 3 protein |
Position | 11q23 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 13846 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 5920 |
Links to all GeneRIF Items | 5920 |
Links to iHOP | 5920 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>5920 : length: 495 atggcttcgccacaccaagagcccaaacctggagacctgattgagattttccgccttggc tatgagcactgggccctgtatataggagatggctacgtgatccatctggctcctccaagt gagtaccccggggctggctcctccagtgtcttctcagtcctgagcaacagtgcagaggtg aaacgggagcgcctggaagatgtggtgggaggctgttgctatcgggtcaacaacagcttg gaccatgagtaccaaccacggcccgtggaggtgatcatcagttctgcgaaggagatggtt ggtcagaagatgaagtacagtattgtgagcaggaactgtgagcactttgtcacccagctg agatatggcaagtcccgctgtaaacaggtggaaaaggccaaggttgaagttggtgtggcc acggcgcttggaatcctggttgttgctggatgctcttttgcgattaggagataccaaaaa aaagcgacagcctga |
Protein Sequence |
>5920 : length: 164 MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEV KRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQL RYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA |