| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 5936 |
Name | RBM4 |
Synonym | LARK|RBM4A|ZCCHC21|ZCRB3A;RNA binding motif protein 4;RBM4;RNA binding motif protein 4 |
Definition | RNA-binding motif protein 4a|RNA-binding protein 4|lark homolog|transcriptional coactivator CoAZ|zinc finger CCHC-type and RNA binding motif 3A |
Position | 11q13 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 13911 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 5936 |
Links to all GeneRIF Items | 5936 |
Links to iHOP | 5936 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>5936 : length: 432 atggtgaagctgttcatcggaaacctgccccgggaggctacagagcaggagattcgctca ctcttcgagcagtatgggaaggtgctggaatgtgacatcattaagaattacggctttgtg cacatagaagacaagacggcagctgaggatgccatacgcaacctgcaccattacaagctt catggggtgaacatcaacgtggaagccagcaagaataagagcaaaacctcaacaaagttg catgtgggcaacatcagtcccacctgcaccaataaggagcttcgagccaagtttgaggag tatggtccggtcatcgaatgtgacatcgtgaaagattatgccttcgtacacatggagcgg gcagaggatgcagtggaggccatcaggggccttgataacacagagtttcaaggtgggatg tgtgtgggctga |
Protein Sequence |
>5936 : length: 143 MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKL HGVNINVEASKNKSKTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDYAFVHMER AEDAVEAIRGLDNTEFQGGMCVG |