| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 5947 |
Name | RBP1 |
Synonym | CRABP-I|CRBP|CRBP1|CRBPI|RBPC;retinol binding protein 1, cellular;RBP1;retinol binding protein 1, cellular |
Definition | CRBP-I|cellular retinol-binding protein I|retinol-binding protein 1|retinol-binding protein 1, cellular |
Position | 3q23 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 13928 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | Retinoic acid receptors-mediated signaling;PID Curated;200142 |
Disease | Cirrhosis;FunDO |
Disease | Cancer;FunDO |
Disease | Rheumatoid arthritis;FunDO |
|
External Links |
|
Links to Entrez Gene | 5947 |
Links to all GeneRIF Items | 5947 |
Links to iHOP | 5947 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>5947 : length: 474 atggatcctcccgcaggctttgtgcgcgctgggaatccagctgtcgccgccccgcagagc cccctgtccccggagggcgctcatttccgggccgcccaccacccgcgtagcaccggcagc cgctgtcccggcagtctccagccgtcccgcccgcttgtggccaactggctccagtcactc cccgaaatgccagtcgacttcactgggtactggaagatgttggtcaacgagaatttcgag gagtacctgcgcgccctcgacgtcaatgtggccttgcgcaaaatcgccaacttgctgaag ccagacaaagagatcgtgcaggacggtgaccatatgatcatccgcacgctgagcactttt aggaactacatcatggacttccaggttgggaaggagtttgaggaggatctgacaggcata gatgaccgcaagtgcatggctggagtgcaatcgcgtgatctcagctcactgtaa |
Protein Sequence |
>5947 : length: 157 MDPPAGFVRAGNPAVAAPQSPLSPEGAHFRAAHHPRSTGSRCPGSLQPSRPLVANWLQSL PEMPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTF RNYIMDFQVGKEFEEDLTGIDDRKCMAGVQSRDLSSL |