| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 6273 |
Name | S100A2 |
Synonym | CAN19|S100L;S100 calcium binding protein A2;S100A2;S100 calcium binding protein A2 |
Definition | S100 calcium-binding protein A2|protein S100-A2 |
Position | 1q21 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 14481 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | Direct p53 effectors;PID Curated;200101 |
Disease | Cancer;FunDO |
Disease | Neck cancer;FunDO |
Disease | Keratoconus;FunDO |
|
External Links |
|
Links to Entrez Gene | 6273 |
Links to all GeneRIF Items | 6273 |
Links to iHOP | 6273 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>6273 : length: 294 atgtgcagttctctggagcaggcgctggctgtgctggtcactaccttccacaagtactcc tgccaagagggcgacaagttcaagctgagtaagggggaaatgaaggaacttctgcacaag gagctgcccagctttgtgggggagaaagtggatgaggaggggctgaagaagctgatgggc agcctggatgagaacagtgaccagcaggtggacttccaggagtatgctgttttcctggca ctcatcactgtcatgtgcaatgacttcttccagggctgcccagaccgaccctga |
Protein Sequence |
>6273 : length: 97 MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMG SLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP |