| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 6390 |
Name | SDHB |
Synonym | CWS2|IP|PGL4|SDH|SDH1|SDH2|SDHIP;succinate dehydrogenase complex, subunit B, iron sulfur (Ip);SDHB;succinate dehydrogenase complex, subunit B, iron sulfur (Ip) |
Definition | iron-sulfur subunit of complex II|succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial |
Position | 1p36.1-p35 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 14656 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins.;Reactome;REACT:6305 |
Pathway | Pyruvate metabolism and Citric Acid (TCA) cycle;Reactome;REACT:1046 |
Pathway | Citrate cycle (TCA cycle);KEGG PATHWAY;hsa00020 |
Pathway | Metabolic pathways;KEGG PATHWAY;hsa01100 |
Pathway | Oxidative phosphorylation;KEGG PATHWAY;hsa00190 |
Pathway | TCA cycle variation III (eukaryotic);BioCyc;PWY-5690 |
Pathway | Alzheimer's disease;KEGG PATHWAY;hsa05010 |
Pathway | Huntington's disease;KEGG PATHWAY;hsa05016 |
Pathway | Parkinson's disease;KEGG PATHWAY;hsa05012 |
Disease | Cowden-like syndrome;OMIM |
Disease | extra-adrenal and/or malignant phaeochromocytomas;GAD |
Disease | Paraganglioma, familial chromaffin, 4;OMIM |
Disease | prolonged survival associated;GAD |
Disease | pheochromocytomas;GAD |
Disease | paragangliomas;GAD |
Disease | head and neck cancer;GAD |
Disease | Paraganglioma and gastric stromal sarcoma;OMIM |
Disease | CANCER;GAD |
Disease | Cancer;FunDO |
Disease | paragangliomas, head and neck;GAD |
Disease | Pheochromocytoma;OMIM |
Disease | DEVELOPMENTAL;GAD |
Disease | height;GAD |
|
External Links |
|
Links to Entrez Gene | 6390 |
Links to all GeneRIF Items | 6390 |
Links to iHOP | 6390 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>6390 : length: 843 atggcggcggtggtcgccctctccttgaggcgccggttgccggccacaacccttggcgga gcctgcctgcaggcctcccgaggagcccagacagctgcagccacagctccccgtatcaag aaatttgccatctatcgatgggacccagacaaggctggagacaaacctcatatgcagact tatgaagttgaccttaataaatgtggccccatggtattggatgctttaatcaagattaag aatgaagttgactctactttgaccttccgaagatcatgcagagaaggcatctgtggctct tgtgcaatgaacatcaatggaggcaacactctagcttgcacccgaaggattgacaccaac ctcaataaggtctcaaaaatctaccctcttccacacatgtatgtgataaaggatcttgtt cccgatttgagcaacttctatgcacagtacaaatccattgagccttatttgaagaagaag gatgaatctcaggaaggcaagcagcagtatctgcagtccatagaagagcgtgagaaactg gacgggctctacgagtgcattctctgtgcctgctgtagcaccagctgccccagctactgg tggaacggagacaaatatctggggcctgcagttcttatgcaggcctatcgctggatgatt gactccagagatgacttcacagaggagcgcctggccaagctgcaggacccattctctcta taccgctgccacaccatcatgaactgcacaaggacctgtcctaagggtctgaatccaggg aaagctattgcagagatcaagaaaatgatggcaacctataaggagaagaaagcttcagtt taa |
Protein Sequence |
>6390 : length: 280 MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQT YEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKL DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV |