| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 6648 |
Name | SOD2 |
Synonym | IPOB|MNSOD|MVCD6;superoxide dismutase 2, mitochondrial;SOD2;superoxide dismutase 2, mitochondrial |
Definition | Mn superoxide dismutase|indophenoloxidase B|manganese-containing superoxide dismutase|mangano-superoxide dismutase|superoxide dismutase [Mn], mitochondrial |
Position | 6q25.3 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 15522 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | erythropoietin mediated neuroprotection through nf-kb;PID BioCarta;100176 |
Pathway | Huntington's disease;KEGG PATHWAY;hsa05016 |
Pathway | superoxide radicals degradation;BioCyc;DETOX1-PWY |
Pathway | FoxO family signaling;PID Curated;200091 |
Pathway | Peroxisome;KEGG PATHWAY;hsa04146 |
Disease | Lupus erythematosus;FunDO |
Disease | cirrhosis, alcoholic;GAD |
Disease | IMMUNE;GAD |
Disease | Prostatic Neoplasms;GAD |
Disease | Albuminuria;GAD |
Disease | radiotherapy response;GAD |
Disease | Alzheimer's disease;GAD |
Disease | breast cancer;GAD |
Disease | carotid atherosclerosis;GAD |
Disease | Asthma;FunDO |
Disease | diabetes, type 2;GAD |
Disease | Cancer;FunDO |
Disease | Microvascular complications of diabetes, susceptibility to, 6;OMIM |
Disease | bladder cancer;GAD |
Disease | HIV infection;FunDO |
Disease | Glaucoma;FunDO |
Disease | Skin cancer;FunDO |
Disease | AGING;GAD |
Disease | hypertension;GAD |
Disease | prostate cancer;GAD |
Disease | lung cancer;GAD |
Disease | nephropathy in other diseases;GAD |
Disease | Parkinson's disease;GAD |
Disease | schizophrenia tardive dyskinesia;GAD |
Disease | diabetes, neurological manifestations;GAD |
Disease | PHARMACOGENOMIC;GAD |
Disease | cardiomyopathy;GAD |
Disease | Systemic infection;FunDO |
Disease | METABOLIC;GAD |
Disease | Schizophrenia;FunDO |
Disease | Cirrhosis;FunDO |
Disease | Alzheimer's disease;FunDO |
Disease | psoriatic arthritis;GAD |
Disease | colorectal cancer;GAD |
Disease | Pre-Eclampsia;FunDO |
Disease | diabetic polyneuropathy;GAD |
Disease | PSYCH;GAD |
Disease | diabetes, type 1;GAD |
Disease | Lung Neoplasms;GAD |
Disease | liver injury, drug-induced;GAD |
Disease | Psychotic disorder;FunDO |
Disease | CARDIOVASCULAR;GAD |
Disease | Kuhnt-Junius degeneration;FunDO |
Disease | Drug-Induced dyskinesia;FunDO |
Disease | Pancreas disease;FunDO |
Disease | steatohepatitis, non-alcoholic;GAD |
Disease | Chronic obstructive airway disease;FunDO |
Disease | NEUROLOGICAL;GAD |
Disease | tardive dyskinesia;GAD |
Disease | Behcet's Disease;GAD |
Disease | nephropathy, diabetic;GAD |
Disease | Behcet syndrome;FunDO |
Disease | cholesterol;GAD |
Disease | RENAL;GAD |
Disease | leukemia;GAD |
Disease | liver cancer;GAD |
Disease | CANCER;GAD |
Disease | schizophrenia;GAD |
Disease | Barrett's esophagus;FunDO |
Disease | Diabetes Mellitus;GAD |
Disease | aging and longevity;GAD |
Disease | diabetic nephropathy diabetic neuropathy;GAD |
Disease | Arthritis;FunDO |
Disease | stomach cancer;GAD |
Disease | Ankylosing spondylitis;FunDO |
|
External Links |
|
Links to Entrez Gene | 6648 |
Links to all GeneRIF Items | 6648 |
Links to iHOP | 6648 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>6648 : length: 669 atgttgagccgggcagtgtgcggcaccagcaggcagctggctccggttttggggtatctg ggctccaggcagaagcacagcctccccgacctgccctacgactacggcgccctggaacct cacatcaacgcgcagatcatgcagctgcaccacagcaagcaccacgcggcctacgtgaac aacctgaacgtcaccgaggagaagtaccaggaggcgttggccaagggagatgttacagcc cagatagctcttcagcctgcactgaagttcaatggtggtggtcatatcaatcatagcatt ttctggacaaacctcagccctaacggtggtggagaacccaaaggggagttgctggaagcc atcaaacgtgactttggttcctttgacaagtttaaggagaagctgacggctgcatctgtt ggtgtccaaggctcaggttggggttggcttggtttcaataaggaacggggacacttacaa attgctgcttgtccaaatcaggatccactgcaaggaacaacaggccttattccactgctg gggattgatgtgtgggagcacgcttactaccttcagtataaaaatgtcaggcctgattat ctaaaagctatttggaatgtaatcaactgggagaatgtaactgaaagatacatggcttgc aaaaagtaa |
Protein Sequence |
>6648 : length: 222 MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN NLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEA IKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLL GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK |