| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 7078 |
Name | TIMP3 |
Synonym | HSMRK222|K222|K222TA2|SFD;TIMP metallopeptidase inhibitor 3;TIMP3;TIMP metallopeptidase inhibitor 3 |
Definition | MIG-5 protein|TIMP-3|metalloproteinase inhibitor 3|protein MIG-5|tissue inhibitor of metalloproteinases 3 |
Position | 22q12.3 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 16496 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | inhibition of matrix metalloproteinases;PID BioCarta;100045 |
Pathway | p53 signaling pathway;PID BioCarta;100083 |
Disease | Age-related macular degeneration;NHGRI |
Disease | Choriocarcinoma;FunDO |
Disease | Heart failure;FunDO |
Disease | Hamman-Rich syndrome;FunDO |
Disease | Diabetes mellitus;FunDO |
Disease | Intracranial aneurysm;FunDO |
Disease | Macular degeneration;FunDO |
Disease | CARDIOVASCULAR;GAD |
Disease | Rheumatoid arthritis;FunDO |
Disease | Sorsby fundus dystrophy;OMIM |
Disease | Congenital abnormality;FunDO |
Disease | Pigeon breeders disease;GAD |
Disease | Cancer;FunDO |
Disease | pulmonary fibrosis;GAD |
Disease | Aortic aneurysm;FunDO |
Disease | Bronchial disease;FunDO |
|
External Links |
|
Links to Entrez Gene | 7078 |
Links to all GeneRIF Items | 7078 |
Links to iHOP | 7078 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>7078 : length: 636 atgaccccttggctcgggctcatcgtgctcctgggcagctggagcctgggggactggggc gccgaggcgtgcacatgctcgcccagccacccccaggacgccttctgcaactccgacatc gtgatccgggccaaggtggtggggaagaagctggtaaaggaggggcccttcggcacgctg gtctacaccatcaagcagatgaagatgtaccgaggcttcaccaagatgccccatgtgcag tacatccatacggaagcttccgagagtctctgtggccttaagctggaggtcaacaagtac cagtacctgctgacaggtcgcgtctatgatggcaagatgtacacggggctgtgcaacttc gtggagaggtgggaccagctcaccctctcccagcgcaaggggctgaactatcggtatcac ctgggttgtaactgcaagatcaagtcctgctactacctgccttgctttgtgacttccaag aacgagtgtctctggaccgacatgctctccaatttcggttaccctggctaccagtccaaa cactacgcctgcatccggcagaagggcggctactgcagctggtaccgaggatgggccccc ccggataaaagcatcatcaatgccacagacccctga |
Protein Sequence |
>7078 : length: 211 MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTL VYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNF VERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSK HYACIRQKGGYCSWYRGWAPPDKSIINATDP |