| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 80319 |
Name | CXXC4 |
Synonym | IDAX;CXXC finger protein 4;CXXC4;CXXC finger protein 4 |
Definition | CXXC finger 4|CXXC-type zinc finger protein 4|Dvl-binding protein IDAX (inhibition of the Dvl and Axin complex)|inhibition of the Dvl and axin complex protein |
Position | 4q24 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 5596 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | Wnt signaling pathway;KEGG PATHWAY;hsa04310 |
|
External Links |
|
Links to Entrez Gene | 80319 |
Links to all GeneRIF Items | 80319 |
Links to iHOP | 80319 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>80319 : length: 597 atgcaccaccgaaacgactcccagaggctggggaaagctggctgcccgccagagccgtcg ttgcaaatggcaaatactaatttcctctccaccttatcccctgaacactgcagacctttg gcgggggaatgcatgaacaagctcaaatgcggcgctgctgaagcagagataatgaatctc cccgagcgcgtggggactttttccgctatcccggctttagggggcatctcattacctcca ggggtcatcgtcatgacagcccttcactcccccgcagcagcctcagcagccgtcacagac agtgcgtttcaaattgccaatctggcagactgcccgcagaatcattcctcctcctcctcg tcctcctcagggggagctggcggagccaacccagccaagaagaagaggaaaaggtgtggg gtctgcgtgccctgcaagaggctcatcaactgtggcgtctgcagcagttgcaggaaccgc aaaacgggacaccagatctgcaaatttagaaaatgtgaagagctaaagaaaaaacctggc acttcactagagagaacacctgttcccagcgctgaagcattccgatggttcttttaa |
Protein Sequence |
>80319 : length: 198 MHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAEIMNL PERVGTFSAIPALGGISLPPGVIVMTALHSPAAASAAVTDSAFQIANLADCPQNHSSSSS SSSGGAGGANPAKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPG TSLERTPVPSAEAFRWFF |