| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 83742 |
Name | MARVELD1 |
Synonym | GB14|MARVD1|MRVLDC1|bA548K23.8;MARVEL domain containing 1;MARVELD1;MARVEL domain containing 1 |
Definition | MARVEL (membrane-associating) domain containing 1|MARVEL domain-containing protein 1|putative MARVEL domain-containing protein 1 |
Position | 10q24.2 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | N/A |
TUSON P-value | N/A |
|
External Links |
|
Links to Entrez Gene | 83742 |
Links to all GeneRIF Items | 83742 |
Links to iHOP | 83742 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>83742 : length: 522 atgctcccgccgcccccgcgccagccgccgccccaggcgcgtgcggcccgcggcgcggtg cgcctgcagcggcccttcctgcgcagcccgctgggcgtgttgcggctgctgcagctgctg gccggcgctgccttctggatcactatcgccaccagcaagtaccagggccccgtgcacttc gcgctcttcgtgtccgtgctcttctggctgctcaccctgggcctctacttcctcacgctg ctgggcaagcacgagctggtccccgtgctgggctcgcgctggctcatggtcaacgtggcg cacgatgtgctggcggccgcgctctacggcgccgccaccggcatcatgagcgaccagatg cagcgccacagctactgcaacctcaaggattacccgctcccctgcgcctaccacgccttc ctggcggccgccgtctgcggcggcgtctgccacggcctctacctgctttcggcgctctat ggctgcgggcgtcgctgccagggcaagcaggaggtggcgtga |
Protein Sequence |
>83742 : length: 173 MLPPPPRQPPPQARAARGAVRLQRPFLRSPLGVLRLLQLLAGAAFWITIATSKYQGPVHF ALFVSVLFWLLTLGLYFLTLLGKHELVPVLGSRWLMVNVAHDVLAAALYGAATGIMSDQM QRHSYCNLKDYPLPCAYHAFLAAAVCGGVCHGLYLLSALYGCGRRCQGKQEVA |