| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 84417 |
Name | C2orf40 |
Synonym | ECRG4;chromosome 2 open reading frame 40;C2orf40;chromosome 2 open reading frame 40 |
Definition | augurin|esophageal cancer related gene 4 protein|esophageal cancer-related gene 4 protein |
Position | 2q12.2 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 3920 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 84417 |
Links to all GeneRIF Items | 84417 |
Links to iHOP | 84417 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>84417 : length: 447 atggctgcctcccccgcgcggcctgctgtcctggccctgaccgggctggcgctgctcctg ctcctgtgctggggcccaggtggcataagtggaaataaactcaagctgatgcttcaaaaa cgagaagcacctgttccaactaagactaaagtggccgttgatgagaataaagccaaagaa ttccttggcagcctgaagcgccagaagcggcagctgtgggaccggactcggcccgaggtg cagcagtggtaccagcagtttctctacatgggctttgacgaagcgaaatttgaagatgac atcacctattggcttaacagagatcgaaatggacatgaatactatggcgattactaccaa cgtcactatgatgaagactctgcaattggtccccggagcccctacggctttaggcatgga gccagcgtcaactacgatgactactaa |
Protein Sequence |
>84417 : length: 148 MAASPARPAVLALTGLALLLLLCWGPGGISGNKLKLMLQKREAPVPTKTKVAVDENKAKE FLGSLKRQKRQLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQ RHYDEDSAIGPRSPYGFRHGASVNYDDY |