| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 84651 |
Name | SPINK7 |
Synonym | ECG2|ECRG2;serine peptidase inhibitor, Kazal type 7 (putative);SPINK7;serine peptidase inhibitor, Kazal type 7 (putative) |
Definition | ECRG-2|esophagus cancer related gene 2|esophagus cancer-related gene 2 protein|esophagus cancer-related gene-2|serine protease inhibitor Kazal-type 7 |
Position | 5q32 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 15674 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 84651 |
Links to all GeneRIF Items | 84651 |
Links to iHOP | 84651 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>84651 : length: 258 atgaagatcactgggggtctccttctgctctgtacagtggtctatttctgtagcagctca gaagctgctagtctgtctccaaaaaaagtggactgcagcatttacaagaagtatccagtg gtggccatcccctgccccatcacatacctaccagtttgtggttctgactacatcacctat gggaatgaatgtcacttgtgtaccgagagcttgaaaagtaatggaagagttcagtttctt cacgatggaagttgctaa |
Protein Sequence |
>84651 : length: 85 MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITY GNECHLCTESLKSNGRVQFLHDGSC |