| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 9636 |
Name | ISG15 |
Synonym | G1P2|IFI15|IMD38|IP17|UCRP|hUCRP;ISG15 ubiquitin-like modifier;ISG15;ISG15 ubiquitin-like modifier |
Definition | interferon, alpha-inducible protein (clone IFI-15K)|interferon-induced 17-kDa/15-kDa protein|interferon-stimulated protein, 15 kDa|ubiquitin cross-reactive protein|ubiquitin-like protein ISG15 |
Position | 1p36.33 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 9045 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | RIG-I-like receptor signaling pathway;KEGG PATHWAY;hsa04622 |
Disease | Melanoma;FunDO |
Disease | Rheumatoid arthritis;FunDO |
|
External Links |
|
Links to Entrez Gene | 9636 |
Links to all GeneRIF Items | 9636 |
Links to iHOP | 9636 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>9636 : length: 498 atgggctgggacctgacggtgaagatgctggcgggcaacgaattccaggtgtccctgagc agctccatgtcggtgtcagagctgaaggcgcagatcacccagaagatcggcgtgcacgcc ttccagcagcgtctggctgtccacccgagcggtgtggcgctgcaggacagggtccccctt gccagccagggcctgggccccggcagcacggtcctgctggtggtggacaaatgcgacgaa cctctgagcatcctggtgaggaataacaagggccgcagcagcacctacgaggtacggctg acgcagaccgtggcccacctgaagcagcaagtgagcgggctggagggtgtgcaggacgac ctgttctggctgaccttcgaggggaagcccctggaggaccagctcccgctgggggagtac ggcctcaagcccctgagcaccgtgttcatgaatctgcgcctgcggggaggcggcacagag cctggcgggcggagctaa |
Protein Sequence |
>9636 : length: 165 MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPL ASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDD LFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS |