| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1027 |
Name | CDKN1B |
Synonym | CDKN4|KIP1|MEN1B|MEN4|P27KIP1;cyclin-dependent kinase inhibitor 1B (p27, Kip1);CDKN1B;cyclin-dependent kinase inhibitor 1B (p27, Kip1) |
Definition | cyclin-dependent kinase inhibitor 1B |
Position | 12p13.1-p12 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PH | "Cyclin-dependent kinase inhibitor p27Kip1, but not p21WAF1/Cip1, is required for inhibition of hypoxia-induced pulmonary hypertension and remodeling by heparin in mice." |
| More detail of all Mouse literatures about CDKN1B | |
|
Pathways and Diseases |
|
Pathway | influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054 |
Pathway | Regulation of retinoblastoma protein;PID Curated;200191 |
Pathway | DNA Replication;Reactome;REACT:383 |
Pathway | Class I PI3K signaling events mediated by Akt;PID Curated;200169 |
Pathway | Small cell lung cancer;KEGG PATHWAY;hsa05222 |
Pathway | RhoA signaling pathway;PID Curated;200007 |
Pathway | cdk regulation of dna replication;PID BioCarta;100110 |
Pathway | cell cycle: g1/s check point;PID BioCarta;100160 |
Pathway | FOXA1 transcription factor network;PID Curated;200194 |
Pathway | pten dependent cell cycle arrest and apoptosis;PID BioCarta;100058 |
Pathway | Regulation of Telomerase;PID Curated;200072 |
Pathway | Regulation of RhoA activity;PID Curated;200050 |
Pathway | Chronic myeloid leukemia;KEGG PATHWAY;hsa05220 |
Pathway | Cyclin A:Cdk2-associated events at S phase entry;PID Reactome;500375 |
Pathway | Notch-mediated HES/HEY network;PID Curated;200196 |
Pathway | Validated targets of C-MYC transcriptional repression;PID Curated;200171 |
Pathway | Signalling by NGF;Reactome;REACT:11061 |
Pathway | ctcf: first multivalent nuclear factor;PID BioCarta;100194 |
Pathway | E2F transcription factor network;PID Curated;200027 |
Pathway | Cyclin E associated events during G1/S transition;PID Reactome;500877 |
Pathway | ErbB signaling pathway;KEGG PATHWAY;hsa04012 |
Pathway | Prostate cancer;KEGG PATHWAY;hsa05215 |
Pathway | AP-1 transcription factor network;PID Curated;200118 |
Pathway | Cell Cycle, Mitotic;Reactome;REACT:152 |
Pathway | Cell cycle;KEGG PATHWAY;hsa04110 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | cyclins and cell cycle regulation;PID BioCarta;100207 |
Pathway | Integrins in angiogenesis;PID Curated;200109 |
Pathway | Cell Cycle Checkpoints;Reactome;REACT:1538 |
Pathway | FoxO family signaling;PID Curated;200091 |
Pathway | Interleukin signaling pathway;PANTHER;P00036 |
Pathway | C-MYB transcription factor network;PID Curated;200130 |
Pathway | regulation of p27 phosphorylation during cell cycle progression;PID BioCarta;100087 |
Disease | Coronary Restenosis;GAD |
Disease | overall effect;GAD |
Disease | Cancer;FunDO |
Disease | Oral cancer;FunDO |
Disease | Ulcerative colitis;FunDO |
Disease | endometriosis;GAD |
Disease | prostate cancer;GAD |
Disease | head and neck cancer;GAD |
Disease | Coronary Artery Disease;GAD |
Disease | Hyperparathyroidism;FunDO |
Disease | Alzheimer's disease;FunDO |
Disease | Proteinuria;FunDO |
Disease | CARDIOVASCULAR;GAD |
Disease | Multiple endocrine neoplasia;FunDO |
Disease | CANCER;GAD |
Disease | Adenovirus infection;FunDO |
Disease | REPRODUCTION;GAD |
Disease | Cancers;KEGG DISEASE |
Disease | Multiple endocrine neoplasia, type IV;OMIM |
Disease | Cancers of the urinary system and male genital organs;KEGG DISEASE |
Disease | breast cancer;GAD |
Disease | Testicular dysfunction;FunDO |
Disease | Prostate cancer;KEGG DISEASE;H00024 |
Disease | ovarian cancer;GAD |
Disease | myocardial infarct;GAD |
|
External Links |
|
Links to Entrez Gene | 1027 |
Links to all GeneRIF Items | 1027 |
Links to iHOP | 1027 |
|
Sequence Information |
|
Nucleotide Sequence |
>1027 : length: 597 atgtcaaacgtgcgagtgtctaacgggagccctagcctggagcggatggacgccaggcag gcggagcaccccaagccctcggcctgcaggaacctcttcggcccggtggaccacgaagag ttaacccgggacttggagaagcactgcagagacatggaagaggcgagccagcgcaagtgg aatttcgattttcagaatcacaaacccctagagggcaagtacgagtggcaagaggtggag aagggcagcttgcccgagttctactacagacccccgcggccccccaaaggtgcctgcaag gtgccggcgcaggagagccaggatgtcagcgggagccgcccggcggcgcctttaattggg gctccggctaactctgaggacacgcatttggtggacccaaagactgatccgtcggacagc cagacggggttagcggagcaatgcgcaggaataaggaagcgacctgcaaccgacgattct tctactcaaaacaaaagagccaacagaacagaagaaaatgtttcagacggttccccaaat gccggttctgtggagcagacgcccaagaagcctggcctcagaagacgtcaaacgtaa |
Protein Sequence |
>1027 : length: 198 MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG APANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPN AGSVEQTPKKPGLRRRQT |