| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1072 |
Name | CFL1 |
Synonym | CFL;cofilin 1 (non-muscle);CFL1;cofilin 1 (non-muscle) |
Definition | 18 kDa phosphoprotein|cofilin, non-muscle isoform|cofilin-1|p18 |
Position | 11q13 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | "Further analysis revealed that the interaction between LIMK1 and BMPR-II inhibited LIMK1's ability to phosphorylate cofilin, which could then be alleviated by addition of BMP4." |
| More detail of all Human literatures about CFL1 | |
|
Pathways and Diseases |
|
Pathway | CDC42 signaling events;PID Curated;200057 |
Pathway | Fc gamma R-mediated phagocytosis;KEGG PATHWAY;hsa04666 |
Pathway | Hemostasis;Reactome;REACT:604 |
Pathway | ccr3 signaling in eosinophils;PID BioCarta;100215 |
Pathway | Axon guidance;Reactome;REACT:18266 |
Pathway | Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810 |
Pathway | Sema3A PAK dependent Axon repulsion;PID Reactome;500076 |
Pathway | rho cell motility signaling pathway;PID BioCarta;100041 |
Pathway | Axon guidance;KEGG PATHWAY;hsa04360 |
Pathway | RhoA signaling pathway;PID Curated;200007 |
Pathway | CXCR4-mediated signaling events;PID Curated;200083 |
Pathway | RAC1 signaling pathway;PID Curated;200190 |
Pathway | rac1 cell motility signaling pathway;PID BioCarta;100056 |
Pathway | Cytoskeletal regulation by Rho GTPase;PANTHER;P00016 |
Disease | Embryoma;FunDO |
Disease | Colon cancer;FunDO |
Disease | neural tube defects;GAD |
Disease | Spinal dysraphism;FunDO |
Disease | Neuroblastoma;FunDO |
Disease | DEVELOPMENTAL;GAD |
|
External Links |
|
Links to Entrez Gene | 1072 |
Links to all GeneRIF Items | 1072 |
Links to iHOP | 1072 |
|
Sequence Information |
|
Nucleotide Sequence |
>1072 : length: 501 atggcctccggtgtggctgtctctgatggtgtcatcaaggtgttcaacgacatgaaggtg cgtaagtcttcaacgccagaggaggtgaagaagcgcaagaaggcggtgctcttctgcctg agtgaggacaagaagaacatcatcctggaggagggcaaggagatcctggtgggcgatgtg ggccagactgtcgacgacccctacgccacctttgtcaagatgctgccagataaggactgc cgctatgccctctatgatgcaacctatgagaccaaggagagcaagaaggaggatctggtg tttatcttctgggcccccgagtctgcgccccttaagagcaaaatgatttatgccagctcc aaggacgccatcaagaagaagctgacagggatcaagcatgaattgcaagcaaactgctac gaggaggtcaaggaccgctgcaccctggcagagaagctggggggcagtgccgtcatctcc ctggagggcaagcctttgtga |
Protein Sequence |
>1072 : length: 166 MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL |