| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 1073 |
Name | CFL2 |
Synonym | NEM7;cofilin 2 (muscle);CFL2;cofilin 2 (muscle) |
Definition | cofilin, muscle isoform|cofilin-2|nemaline myopathy type 7 |
Position | 14q12 |
Gene Type | protein-coding |
PAH Type | Description |
PAH | "Further analysis revealed that the interaction between LIMK1 and BMPR-II inhibited LIMK1's ability to phosphorylate cofilin, which could then be alleviated by addition of BMP4." |
| More detail of all Human literatures about CFL2 | |
Pathways and Diseases | |
Pathway | Axon guidance;KEGG PATHWAY;hsa04360 |
Pathway | Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810 |
Pathway | Fc gamma R-mediated phagocytosis;KEGG PATHWAY;hsa04666 |
Pathway | Cytoskeletal regulation by Rho GTPase;PANTHER;P00016 |
Pathway | Caspase cascade in apoptosis;PID Curated;200148 |
Disease | Nemaline myopathy 7;OMIM |
External Links | |
Links to Entrez Gene | 1073 |
Links to all GeneRIF Items | 1073 |
Links to iHOP | 1073 |
Sequence Information | |
Nucleotide Sequence | >1073 : length: 501 atggcttctggagttacagtgaatgatgaagtcatcaaagtttttaatgatatgaaagta aggaaatcttctacacaagaggagatcaaaaagagaaagaaagcagttctcttctgttta agcgatgacaaaagacaaataattgtagaggaagcaaagcagatcttggtgggtgacatt ggtgatactgtagaggacccctacacatcttttgtgaagttgctacctctgaatgattgc cgatatgctttgtacgatgccacatacgaaacaaaagagtctaagaaagaagacctagta tttatattctgggctcctgaaagtgcacctttaaaaagcaagatgatttatgctagctct aaagatgccattaaaaagaaatttacaggtattaaacatgagtggcaagtaaatggcttg gatgatattaaggaccgttcgacacttggagagaaattgggaggcaatgtagtagtttca cttgaaggaaaaccattataa |
Protein Sequence | >1073 : length: 166 MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDI GDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL |