| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 1524 |
Name | CX3CR1 |
Synonym | CCRL1|CMKBRL1|CMKDR1|GPR13|GPRV28|V28;chemokine (C-X3-C motif) receptor 1;CX3CR1;chemokine (C-X3-C motif) receptor 1 |
Definition | C-X3-C CKR-1|CMK-BRL-1|CMK-BRL1|CX3C chemokine receptor 1|G protein-coupled receptor 13|G-protein coupled receptor 13|beta chemokine receptor-like 1|chemokine (C-C) receptor-like 1|chemokine (C-X3-C) receptor 1|fractalkine receptor |
Position | 3p21.3 |
Gene Type | protein-coding |
PAH Type | Description |
PAH | CX(3)C chemokine fractalkine in pulmonary arterial hypertension. |
PAH | Polymorphism of the fractalkine receptor CX3CR1 and systemic sclerosis-associated pulmonary arterial hypertension. |
PH | Polymorphism of the fractalkine receptor CX3CR1 and systemic sclerosis-associated pulmonary arterial hypertension. |
| More detail of all Human literatures about CX3CR1 | |
Pathways and Diseases | |
Pathway | Signaling by GPCR;Reactome;REACT:14797 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031 |
Pathway | Chemokine signaling pathway;KEGG PATHWAY;hsa04062 |
Disease | Rapid progression to AIDS from HIV1 infection;OMIM |
Disease | Coronary artery disease, resistance to;OMIM |
Disease | Bone marrow disease;FunDO |
Disease | Macular degeneration;FunDO |
Disease | Cytomegalovirus infection;FunDO |
Disease | Atopic rhinitis;FunDO |
Disease | Asthma;FunDO |
Disease | Hepatitis C;FunDO |
Disease | Purpura, Thrombocytopenic, Idiopathic;FunDO |
Disease | Intestinal Obstruction;GAD |
Disease | Liver cancer;FunDO |
Disease | Acute Coronary Syndrome;GAD |
Disease | intima-media thickness;GAD |
Disease | Dermatitis;FunDO |
Disease | Prostate cancer;FunDO |
Disease | atherosclerosis, coronary;GAD |
Disease | IMMUNE;GAD |
Disease | HIV;GAD |
Disease | Rheumatoid arthritis;FunDO |
Disease | cardiovascular disease;GAD |
Disease | coronary vascular endothelial dysfunction;GAD |
Disease | Systemic infection;FunDO |
Disease | Dental plaque;FunDO |
Disease | pulmonary arterial hypertension sclerosis, systemic;GAD |
Disease | Stroke;FunDO |
Disease | restenosis;GAD |
Disease | Kidney disease;FunDO |
Disease | Colon cancer;FunDO |
Disease | Vascular disease;FunDO |
Disease | Macular degeneration, age-related, susceptibility to;OMIM |
Disease | Aortic aneurysm;FunDO |
Disease | Coronary Artery Disease;GAD |
Disease | respiratory syncytial virus;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | Multiple sclerosis;FunDO |
Disease | Spinal cord disease;FunDO |
Disease | cerebrovascular disease;GAD |
Disease | Glioblastoma;GAD |
Disease | Crohn Disease;GAD |
Disease | Enteritis;FunDO |
Disease | CANCER;GAD |
Disease | Lymphoma;FunDO |
Disease | Human Renal Transplantation;GAD |
Disease | INFECTION;GAD |
Disease | retinal vascular occlusion;GAD |
Disease | coronary artery disease, occlusive;GAD |
Disease | Atherosclerosis;GAD |
Disease | RENAL;GAD |
Disease | Uveitis;FunDO |
Disease | VISION;GAD |
Disease | Atherosclerosis;FunDO |
External Links | |
Links to Entrez Gene | 1524 |
Links to all GeneRIF Items | 1524 |
Links to iHOP | 1524 |
Sequence Information | |
Nucleotide Sequence | >1524 : length: 1068 atggatcagttccctgaatcagtgacagaaaactttgagtacgatgatttggctgaggcc tgttatattggggacatcgtggtctttgggactgtgttcctgtccatattctactccgtc atctttgccattggcctggtgggaaatttgttggtagtgtttgccctcaccaacagcaag aagcccaagagtgtcaccgacatttacctcctgaacctggccttgtctgatctgctgttt gtagccactttgcccttctggactcactatttgataaatgaaaagggcctccacaatgcc atgtgcaaattcactaccgccttcttcttcatcggcttttttggaagcatattcttcatc accgtcatcagcattgataggtacctggccatcgtcctggccgccaactccatgaacaac cggaccgtgcagcatggcgtcaccatcagcctaggcgtctgggcagcagccattttggtg gcagcaccccagttcatgttcacaaagcagaaagaaaatgaatgccttggtgactacccc gaggtcctccaggaaatctggcccgtgctccgcaatgtggaaacaaattttcttggcttc ctactccccctgctcattatgagttattgctacttcagaatcatccagacgctgttttcc tgcaagaaccacaagaaagccaaagccattaaactgatccttctggtggtcatcgtgttt ttcctcttctggacaccctacaacgttatgattttcctggagacgcttaagctctatgac ttctttcccagttgtgacatgaggaaggatctgaggctggccctcagtgtgactgagacg gttgcatttagccattgttgcctgaatcctctcatctatgcatttgctggggagaagttc agaagatacctttaccacctgtatgggaaatgcctggctgtcctgtgtgggcgctcagtc cacgttgatttctcctcatctgaatcacaaaggagcaggcatggaagtgttctgagcagc aattttacttaccacacgagtgatggagatgcattgctccttctctga |
Protein Sequence | >1524 : length: 355 MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSK KPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFI TVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYP EVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVF FLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKF RRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL |