| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1545 |
Name | CYP1B1 |
Synonym | CP1B|CYPIB1|GLC3A|P4501B1;cytochrome P450, family 1, subfamily B, polypeptide 1;CYP1B1;cytochrome P450, family 1, subfamily B, polypeptide 1 |
Definition | aryl hydrocarbon hydroxylase|cytochrome P450 1B1|cytochrome P450, subfamily I (dioxin-inducible), polypeptide 1 (glaucoma 3, primary infantile)|flavoprotein-linked monooxygenase|microsomal monooxygenase|xenobiotic monooxygenase |
Position | 2p22.2 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | Alterations in oestrogen metabolism: implications for higher penetrance of familial pulmonary arterial hypertension in females. |
PAH | "Serotonin transporter, sex, and hypoxia: microarray analysis in the pulmonary arteries of mice identifies genes with relevance to human PAH." |
PAH | Pulmonary CYP1B1 is increased in human pulmonary arterial hypertension and is highly expressed in the pulmonary vascular wall. Inhibition abolished estrogen-indexed proliferation in normal and PAH smooth muscle cells. |
PAH | "CYP1B1-mediated estrogen metabolism promotes the development of pulmonary arterial hypertension, likely via the formation of mitogens, including 16alpha-hydroxyestrone." |
PAH | "The female predisposition to IPAH may also be related to aberrant expression of a cytochrome, CYP1B1, that leads to a mitogenic estrogen metabolite." |
| More detail of all Human literatures about CYP1B1 | |
|
Pathways and Diseases |
|
Pathway | Steroid hormone biosynthesis;KEGG PATHWAY;hsa00140 |
Pathway | Metabolism of xenobiotics by cytochrome P450;KEGG PATHWAY;hsa00980 |
Pathway | Biological oxidations;Reactome;REACT:13433 |
Pathway | Endogenous sterols;PID Reactome;500195 |
Pathway | Tryptophan metabolism;KEGG PATHWAY;hsa00380 |
Disease | Glaucoma, primary open angle, adult-onset;OMIM |
Disease | liver cancer;GAD |
Disease | menarche;GAD |
Disease | breast and lung cancer;GAD |
Disease | catecholestrogen metabolism;GAD |
Disease | Cancer;FunDO |
Disease | estrogens;GAD |
Disease | Glaucoma;FunDO |
Disease | Chronic simple glaucoma;FunDO |
Disease | Glaucoma 3A, primary congenital;OMIM |
Disease | lung cancer;GAD |
Disease | VISION;GAD |
Disease | prostate cancer;GAD |
Disease | glaucoma, primary congenital;GAD |
Disease | glaucoma;GAD |
Disease | colorectal cancer;GAD |
Disease | METABOLIC;GAD |
Disease | menopause;GAD |
Disease | pregnancy loss;GAD |
Disease | glaucoma, primary open-angle ocular hypertension;GAD |
Disease | glaucoma, primary open-angle;GAD |
Disease | Peters anomaly;OMIM |
Disease | CANCER;GAD |
Disease | Endometriosis;FunDO |
Disease | 1-hyrdoxypyrene glucuronide concentrations;GAD |
Disease | catecholestrogen formation;GAD |
Disease | REPRODUCTION;GAD |
Disease | breast cancer;GAD |
Disease | Glaucoma, primary open angle, juvenile-onset;OMIM |
Disease | sex hormones;GAD |
Disease | Congenital abnormality;FunDO |
Disease | Glaucoma, early-onset, digenic;OMIM |
Disease | endometrial cancer;GAD |
Disease | PAH-DNA adducts;GAD |
|
External Links |
|
Links to Entrez Gene | 1545 |
Links to all GeneRIF Items | 1545 |
Links to iHOP | 1545 |
|
Sequence Information |
|
Nucleotide Sequence |
>1545 : length: 1632 atgggcaccagcctcagcccgaacgacccttggccgctaaacccgctgtccatccagcag accacgctcctgctactcctgtcggtgctggccactgtgcatgtgggccagcggctgctg aggcaacggaggcggcagctccggtccgcgcccccgggcccgtttgcgtggccactgatc ggaaacgcggcggcggtgggccaggcggctcacctctcgttcgctcgcctggcgcggcgc tacggcgacgttttccagatccgcctgggcagctgccccatagtggtgctgaatggcgag cgcgccatccaccaggccctggtgcagcagggctcggccttcgccgaccggccggccttc gcctccttccgtgtggtgtccggcggccgcagcatggctttcggccactactcggagcac tggaaggtgcagcggcgcgcagcccacagcatgatgcgcaacttcttcacgcgccagccg cgcagccgccaagtcctcgagggccacgtgctgagcgaggcgcgcgagctggtggcgctg ctggtgcgcggcagcgcggacggcgccttcctcgacccgaggccgctgaccgtcgtggcc gtggccaacgtcatgagtgccgtgtgtttcggctgccgctacagccacgacgaccccgag ttccgtgagctgctcagccacaacgaagagttcgggcgcacggtgggcgcgggcagcctg gtggacgtgatgccctggctgcagtacttccccaacccggtgcgcaccgttttccgcgaa ttcgagcagctcaaccgcaacttcagcaacttcatcctggacaagttcttgaggcactgc gaaagccttcggcccggggccgccccccgcgacatgatggacgcctttatcctctctgcg gaaaagaaggcggccggggactcgcacggtggtggcgcgcggctggatttggagaacgta ccggccactatcactgacatcttcggcgccagccaggacaccctgtccaccgcgctgcag tggctgctcctcctcttcaccaggtatcctgatgtgcagactcgagtgcaggcagaattg gatcaggtcgtggggagggaccgtctgccttgtatgggtgaccagcccaacctgccctat gtcctggccttcctttatgaagccatgcgcttctccagctttgtgcctgtcactattcct catgccaccactgccaacacctctgtcttgggctaccacattcccaaggacactgtggtt tttgtcaaccagtggtctgtgaatcatgacccactgaagtggcctaacccggagaacttt gatccagctcgattcttggacaaggatggcctcatcaacaaggacctgaccagcagagtg atgattttttcagtgggcaaaaggcggtgcattggcgaagaactttctaagatgcagctt tttctcttcatctccatcctggctcaccagtgcgatttcagggccaacccaaatgagcct gcgaaaatgaatttcagttatggtctaaccattaaacccaagtcatttaaagtcaatgtc actctcagagagtccatggagctccttgatagtgctgtccaaaatttacaagccaaggaa acttgccaataa |
Protein Sequence |
>1545 : length: 543 MGTSLSPNDPWPLNPLSIQQTTLLLLLSVLATVHVGQRLLRQRRRQLRSAPPGPFAWPLI GNAAAVGQAAHLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPAF ASFRVVSGGRSMAFGHYSEHWKVQRRAAHSMMRNFFTRQPRSRQVLEGHVLSEARELVAL LVRGSADGAFLDPRPLTVVAVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSL VDVMPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHCESLRPGAAPRDMMDAFILSA EKKAAGDSHGGGARLDLENVPATITDIFGASQDTLSTALQWLLLLFTRYPDVQTRVQAEL DQVVGRDRLPCMGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVV FVNQWSVNHDPLKWPNPENFDPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQL FLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKE TCQ |