| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1906 |
Name | EDN1 |
Synonym | ET1|HDLCQ7|PPET1;endothelin 1;EDN1;endothelin 1 |
Definition | endothelin-1|preproendothelin-1 |
Position | 6p24.1 |
Gene Type | protein-coding |
|
PAH Type |
Description |
HPH | ET-1 and VEGF play important roles in the pathogenesis of hypoxic pulmonary hypertension. |
HPH | VEGF and ET-1 participate the muscularization of pulmonary vessels during hypoxia and play an important role in the process of hypoxic pulmonary hypertension in rats. |
PAH | Induction of apoptosis and endothelin-1 secretion in primary human lung endothelial cells by HIV-1 gp120 proteins. |
PAH | Hemodynamic and clinical correlates of endothelin-1 in chronic thromboembolic pulmonary hypertension. |
PAH | [Assessment of plasma endothelin level measurement in systemic sclerosis]. |
PAH | Exhaled and arterial levels of endothelin-1 are increased and correlate with pulmonary systolic pressure in COPD with pulmonary hypertension. |
PAH | Potential biomarkers for detecting pulmonary arterial hypertension in patients with systemic sclerosis. |
PAH | Endothelin-1 inhibits background two-pore domain channel TASK-1 in primary human pulmonary artery smooth muscle cells. |
PAH | BMPR2 mutation alters the lung macrophage endothelin-1 cascade in a mouse model and patients with heritable pulmonary artery hypertension. |
PAH | Bone morphogenic protein-9 stimulates endothelin-1 release from human pulmonary microvascular endothelial cells: a potential mechanism for elevated ET-1 levels in pulmonary arterial hypertension. |
| More detail of all Rat literatures about EDN1 | |
|
Pathways and Diseases |
|
Pathway | nfat and hypertrophy of the heart ;PID BioCarta;100098 |
Pathway | Melanogenesis;KEGG PATHWAY;hsa04916 |
Pathway | Endothelins;PID Curated;200004 |
Pathway | EGFR-dependent Endothelin signaling events;PID Curated;200095 |
Pathway | Wnt signaling pathway;PANTHER;P00057 |
Pathway | Endothelin signaling pathway;PANTHER;P00019 |
Pathway | hypoxia-inducible factor in the cardivascular system;PID BioCarta;100145 |
Pathway | AP-1 transcription factor network;PID Curated;200118 |
Pathway | HIF-1-alpha transcription factor network;PID Curated;200172 |
Pathway | Signaling by GPCR;Reactome;REACT:14797 |
Pathway | role of egf receptor transactivation by gpcrs in cardiac hypertrophy;PID BioCarta;100221 |
Disease | Polycythemia;FunDO |
Disease | Ischemia;FunDO |
Disease | Primary tumor;FunDO |
Disease | Osteitis deformans;FunDO |
Disease | Bladder cancer;FunDO |
Disease | Bone metastases;FunDO |
Disease | Atopic rhinitis;FunDO |
Disease | Melanoma;FunDO |
Disease | diabetes, type 2;GAD |
Disease | Polyarthritis;FunDO |
Disease | Respiratory distress syndrome;FunDO |
Disease | left ventricular hypertrophy;GAD |
Disease | Breast cancer;FunDO |
Disease | cirrhosis;GAD |
Disease | vitiligo;GAD |
Disease | Subarachnoid hemorrhage;FunDO |
Disease | Embryoma;FunDO |
Disease | hypertension;GAD |
Disease | Amnionitis;FunDO |
Disease | Gingival overgrowth;FunDO |
Disease | VISION;GAD |
Disease | IMMUNE;GAD |
Disease | Systemic scleroderma;FunDO |
Disease | Endemic goiter;FunDO |
Disease | Rheumatoid arthritis;FunDO |
Disease | Pulmonary fibrosis;FunDO |
Disease | Vitiligo;FunDO |
Disease | Systemic infection;FunDO |
Disease | METABOLIC;GAD |
Disease | Stroke;FunDO |
Disease | Asthma;GAD |
Disease | Kidney disease;FunDO |
Disease | Colon cancer;FunDO |
Disease | Prostatic hypertrophy, Benign;FunDO |
Disease | Heart Failure;GAD |
Disease | Capillaries disease;FunDO |
Disease | Gastritis;FunDO |
Disease | Diabetes mellitus;FunDO |
Disease | Hypertension;FunDO |
Disease | CARDIOVASCULAR;GAD |
Disease | Hyperinsulinism;FunDO |
Disease | CANCER;GAD |
Disease | blood pressure, arterial;GAD |
Disease | Basal cell carcinoma;FunDO |
Disease | glaucoma;GAD |
Disease | Brain tumor;FunDO |
Disease | lymphoma, cutaneous T-cell;GAD |
Disease | Graves' disease;FunDO |
Disease | kidney dysfunction;GAD |
Disease | plasma endothelin-1 levels;GAD |
Disease | glaucoma, primary open-angle;GAD |
Disease | Growth retardation;FunDO |
Disease | Heart failure;FunDO |
Disease | Squamous cell cancer;FunDO |
Disease | IGA glomerulonephritis;FunDO |
Disease | Total IgE. Eosinophilia. DRS;GAD |
Disease | Prostate cancer;FunDO |
Disease | Pancreatitis;FunDO |
Disease | Ovarian cancer;FunDO |
Disease | Obesity;FunDO |
Disease | High density lipoprotein cholesterol level QTL 7;OMIM |
Disease | atherosclerosis, coronary cholesterol, HDL;GAD |
Disease | Filariasis;FunDO |
Disease | arrhythmia, cardiac;GAD |
Disease | Rabies;FunDO |
Disease | Asthma;FunDO |
Disease | RENAL;GAD |
Disease | Atherosclerosis;FunDO |
|
External Links |
|
Links to Entrez Gene | 1906 |
Links to all GeneRIF Items | 1906 |
Links to iHOP | 1906 |
|
Sequence Information |
|
Nucleotide Sequence |
>1906 : length: 636 atggattatttgctcatgattttctctctgctgtttgtggcttgccaaggagctccagaa acagtcttaggcgctgagctcagcgcggtgggtgagaacggcggggagaaacccactccc agtccaccctggcggctccgccggtccaagcgctgctcctgctcgtccctgatggataaa gagtgtgtctacttctgccacctggacatcatttgggtcaacactcccgagcacgttgtt ccgtatggacttggaagccctaggtccaagagagccttggagaatttacttcccacaaag gcaacagaccgtgaaaatagatgccaatgtgctagccaaaaagacaagaagtgctggaat ttttgccaagcaggaaaagaactcagggctgaagacattatggagaaagactggaataat cataagaaaggaaaagactgttccaagcttgggaaaaagtgtatttatcagcagttagtg agaggaagaaaaatcagaagaagttcagaggaacacctaagacaaaccaggtcggagacc atgagaaacagcgtcaaatcatcttttcatgatcccaagctgaaaggcaagccctccaga gagcgttatgtgacccacaaccgagcacattggtga |
Protein Sequence |
>1906 : length: 211 MDYLLMIFSLLFVACQGAPETVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDK ECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWN FCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSET MRNSVKSSFHDPKLKGKPSRERYVTHNRAHW |