General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information |
|
---|---|
Gene ID | 2150 |
Name | F2RL1 |
Synonym | GPR11|PAR2;coagulation factor II (thrombin) receptor-like 1;F2RL1;coagulation factor II (thrombin) receptor-like 1 |
Definition | G-protein coupled receptor 11|coagulation factor II receptor-like 1|protease-activated receptor 2|proteinase-activated receptor 2|thrombin receptor-like 1 |
Position | 5q13 |
Gene Type | protein-coding |
PAH Type |
Description |
PH | Study identifies a novel role of PAR-2 in vascular remodeling in the lung and suggests PAR-2 inhibition reverses experimental pulmonary hypertension. |
PH | Study identifies a novel role of PAR-2 in vascular remodeling in the lung and suggests PAR-2 inhibition reverses experimental pulmonary hypertension. |
PH | Study identifies a novel role of PAR-2 in vascular remodeling in the lung and suggests PAR-2 inhibition reverses experimental pulmonary hypertension. |
More detail of all Human literatures about F2RL1 | |
Pathways and Diseases |
|
Pathway | Signaling by GPCR;Reactome;REACT:14797 |
Pathway | Neuroactive ligand-receptor interaction;KEGG PATHWAY;hsa04080 |
Disease | Embryoma;FunDO |
Disease | Atopic rhinitis;FunDO |
Disease | Dermatitis;FunDO |
Disease | Bronchopulmonary dysplasia;FunDO |
Disease | Prostate cancer;FunDO |
Disease | Abortion;FunDO |
Disease | Asthma;FunDO |
Disease | Rheumatoid arthritis;FunDO |
Disease | Multiple sclerosis;FunDO |
Disease | Endometrial cancer;FunDO |
Disease | Respiratory failure;FunDO |
Disease | Papillary adenocarcinoma;FunDO |
Disease | Synovitis;FunDO |
Disease | Systemic infection;FunDO |
Disease | Neoplasm metastasis;FunDO |
Disease | Pancreas cancer;FunDO |
Disease | Endometriosis;FunDO |
Disease | Colon cancer;FunDO |
Disease | Alzheimer's disease;FunDO |
Disease | Vascular disease;FunDO |
Disease | Breast cancer;FunDO |
External Links |
|
Links to Entrez Gene | 2150 |
Links to all GeneRIF Items | 2150 |
Links to iHOP | 2150 |
Sequence Information |
|
Nucleotide Sequence |
>2150 : length: 1194 atgcggagccccagcgcggcgtggctgctgggggccgccatcctgctagcagcctctctc tcctgcagtggcaccatccaaggaaccaatagatcctctaaaggaagaagccttattggt aaggttgatggcacatcccacgtcactggaaaaggagttacagttgaaacagtcttttct gtggatgagttttctgcatctgtcctcactggaaaactgaccactgtcttccttccaatt gtctacacaattgtgtttgtggtgggtttgccaagtaacggcatggccctgtgggtcttt cttttccgaactaagaagaagcaccctgctgtgatttacatggccaatctggccttggct gacctcctctctgtcatctggttccccttgaagattgcctatcacatacatggcaacaac tggatttatggggaagctctttgtaatgtgcttattggctttttctatggcaacatgtac tgttccattctcttcatgacctgcctcagtgtgcagaggtattgggtcatcgtgaacccc atggggcactccaggaagaaggcaaacattgccattggcatctccctggcaatatggctg ctgattctgctggtcaccatccctttgtatgtcgtgaagcagaccatcttcattcctgcc ctgaacatcacgacctgtcatgatgttttgcctgagcagctcttggtgggagacatgttc aattacttcctctctctggccattggggtctttctgttcccagccttcctcacagcctct gcctatgtgctgatgatcagaatgctgcgatcttctgccatggatgaaaactcagagaag aaaaggaagagggccatcaaactcattgtcactgtcctggccatgtacctgatctgcttc actcctagtaaccttctgcttgtggtgcattattttctgattaagagccagggccagagc catgtctatgccctgtacattgtagccctctgcctctctacccttaacagctgcatcgac ccctttgtctattactttgtttcacatgatttcagggatcatgcaaagaacgctctcctt tgccgaagtgtccgcactgtaaagcagatgcaagtatccctcacctcaaagaaacactcc aggaaatccagctcttactcttcaagttcaaccactgttaagacctcctattga |
Protein Sequence |
>2150 : length: 397 MRSPSAAWLLGAAILLAASLSCSGTIQGTNRSSKGRSLIGKVDGTSHVTGKGVTVETVFS VDEFSASVLTGKLTTVFLPIVYTIVFVVGLPSNGMALWVFLFRTKKKHPAVIYMANLALA DLLSVIWFPLKIAYHIHGNNWIYGEALCNVLIGFFYGNMYCSILFMTCLSVQRYWVIVNP MGHSRKKANIAIGISLAIWLLILLVTIPLYVVKQTIFIPALNITTCHDVLPEQLLVGDMF NYFLSLAIGVFLFPAFLTASAYVLMIRMLRSSAMDENSEKKRKRAIKLIVTVLAMYLICF TPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALL CRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY |