| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 26585 |
Name | GREM1 |
Synonym | CKTSF1B1|DAND2|DRM|GREMLIN|IHG-2;gremlin 1, DAN family BMP antagonist;GREM1;gremlin 1, DAN family BMP antagonist |
Definition | DAN domain family member 2|cell proliferation-inducing gene 2 protein|cysteine knot superfamily 1, BMP antagonist 1|down-regulated in Mos-transformed cells protein|gremlin 1, cysteine knot superfamily, homolog|gremlin 1-like protein|gremlin-1|increased in |
Position | 15q13.3 |
Gene Type | protein-coding |
|
PAH Type |
Description |
HPH | gremlin 1 was further increased in the walls of small intrapulmonary vessels of mice during the development of hypoxic pulmonary hypertension. |
| More detail of all Mouse literatures about GREM1 | |
|
Pathways and Diseases |
|
Pathway | BMP receptor signaling;PID Curated;200123 |
Disease | Embryoma;FunDO |
Disease | Diabetes mellitus;FunDO |
Disease | nonsyndromic cleft lip with or without cleft palate;GAD |
Disease | Basal cell carcinoma;FunDO |
Disease | Kidney disease;FunDO |
Disease | DEVELOPMENTAL;GAD |
Disease | Hypertension, Pulmonary;FunDO |
|
External Links |
|
Links to Entrez Gene | 26585 |
Links to all GeneRIF Items | 26585 |
Links to iHOP | 26585 |
|
Sequence Information |
|
Nucleotide Sequence |
>26585 : length: 345 atgagccgcacagcctacacggtgggagccctgcatgtgacggagcgcaaatacctgaag cgagactggtgcaaaacccagccgcttaagcagaccatccacgaggaaggctgcaacagt cgcaccatcatcaaccgcttctgttacggccagtgcaactctttctacatccccaggcac atccggaaggaggaaggttcctttcagtcctgctccttctgcaagcccaagaaattcact accatgatggtcacactcaactgccctgaactacagccacctaccaagaagaagagagtc acacgtgtgaagcagtgtcgttgcatatccatcgatttggattaa |
Protein Sequence |
>26585 : length: 114 MSRTAYTVGALHVTERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYGQCNSFYIPRH IRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD |