| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 3119 |
Name | HLA-DQB1 |
Synonym | CELIAC1|HLA-DQB|IDDM1;major histocompatibility complex, class II, DQ beta 1;HLA-DQB1;major histocompatibility complex, class II, DQ beta 1 |
Definition | HLA class II histocompatibility antigen, DQ beta 1 chain|MHC DQ beta|MHC class II DQ beta chain|MHC class II HLA-DQ beta glycoprotein|MHC class II antigen DQB1|MHC class II antigen HLA-DQ-beta-1|MHC class2 antigen|lymphocyte antigen |
Position | 6p21.3 |
Gene Type | protein-coding |
PAH Type | Description |
PAH | Association of HLA class II genes with idiopathic pulmonary arterial hypertension in Koreans. |
| More detail of all Human literatures about HLA-DQB1 | |
Pathways and Diseases | |
Pathway | Antigen processing and presentation;KEGG PATHWAY;hsa04612 |
Pathway | Type I diabetes mellitus;KEGG PATHWAY;hsa04940 |
Pathway | Allograft rejection;KEGG PATHWAY;hsa05330 |
Pathway | Asthma;KEGG PATHWAY;hsa05310 |
Pathway | Viral myocarditis;KEGG PATHWAY;hsa05416 |
Pathway | Staphylococcus aureus infection;KEGG PATHWAY;hsa05150 |
Pathway | Signaling in Immune system;Reactome;REACT:6900 |
Pathway | Systemic lupus erythematosus;KEGG PATHWAY;hsa05322 |
Pathway | Cell adhesion molecules (CAMs);KEGG PATHWAY;hsa04514 |
Pathway | Graft-versus-host disease;KEGG PATHWAY;hsa05332 |
Pathway | Leishmaniasis;KEGG PATHWAY;hsa05140 |
Pathway | Toxoplasmosis;KEGG PATHWAY;hsa05145 |
Pathway | Phagosome;KEGG PATHWAY;hsa04145 |
Pathway | Autoimmune thyroid disease;KEGG PATHWAY;hsa05320 |
Pathway | Intestinal immune network for IgA production;KEGG PATHWAY;hsa04672 |
Disease | vulval lichen sclerosus;GAD |
Disease | liver disease;GAD |
Disease | Sjogren's syndrome;GAD |
Disease | Silicosis;FunDO |
Disease | Drug Hypersensitivity;GAD |
Disease | pollen allergy;GAD |
Disease | Diabetes;KEGG DISEASE |
Disease | Multiple sclerosis;NHGRI |
Disease | Multiple sclerosis, susceptibility to;OMIM |
Disease | IMMUNE;GAD |
Disease | Tuberculosis, Pulmonary;GAD |
Disease | Viral myocarditis;KEGG DISEASE;H00295 |
Disease | Cardiac diseases;KEGG DISEASE |
Disease | typhoid fever;GAD |
Disease | INFECTION;GAD |
Disease | thryoiditis, chronic lymphocytic;GAD |
Disease | clinical tuberculosis;GAD |
Disease | PSYCH;GAD |
Disease | HIV Infections;GAD |
Disease | Metabolic diseases;KEGG DISEASE |
Disease | Celiac disease, susceptibility to;OMIM |
Disease | multiple sclerosis;GAD |
Disease | Enteritis;FunDO |
Disease | Azoospermia;FunDO |
Disease | sarcoidosis;GAD |
Disease | hypertension, pulmonary arterial;GAD |
Disease | primary biliary cirrhosis;GAD |
Disease | glomerulonephritis, Hepatitis B virus-associated;GAD |
Disease | allergy, latex;GAD |
Disease | Syndrome;GAD |
Disease | Lupus erythematosus;FunDO |
Disease | pregnancy loss, recurrent;GAD |
Disease | allergic rhinitis;GAD |
Disease | autoimmune response;GAD |
Disease | lymphoma;GAD |
Disease | Graves' disease;GAD |
Disease | nasal polyposis;GAD |
Disease | sickle cell anemia;GAD |
Disease | Liver cancer;FunDO |
Disease | rhinosinuitis, allergic fungal;GAD |
Disease | Dermatitis;FunDO |
Disease | sclerosis, systemic;GAD |
Disease | HIV;GAD |
Disease | cardiac sarcoidosis;GAD |
Disease | pemphigus;GAD |
Disease | diabetes, type 1;GAD |
Disease | myasthenia gravis;GAD |
Disease | Immune system diseases;KEGG DISEASE |
Disease | pancreatitis, autoimmune;GAD |
Disease | pemphigoid, mucous membrane;GAD |
Disease | Follicular lymphoma;NHGRI |
Disease | Systemic lupus erythematosus;KEGG DISEASE;H00080 |
Disease | allergy;GAD |
Disease | hypothyroidism, goitrous juvenile autoimmune;GAD |
Disease | dermatomyosis;GAD |
Disease | thyroid autoimmunity;GAD |
Disease | knee osteoarthritis;GAD |
Disease | vitiligo;GAD |
Disease | human papillomavirus infection;GAD |
Disease | Type I diabetes mellitus;KEGG DISEASE;H00408 |
Disease | Azoospermia;GAD |
Disease | schizophrenia;GAD |
Disease | Allergies and autoimmune diseases;KEGG DISEASE |
Disease | ulcerative colitis;GAD |
Disease | Common wart;FunDO |
Disease | H. pylori infection stomach cancer;GAD |
Disease | cervical dysplasia H. pylori infection;GAD |
Disease | thalassemia;GAD |
Disease | HEMATOLOGICAL;GAD |
Disease | polymyositis;GAD |
Disease | Asthma;FunDO |
Disease | infertility, tubal factor;GAD |
Disease | rheumatic heart disease;GAD |
Disease | Addison's disease;GAD |
Disease | diabetes, type 1 diabetes, type 2;GAD |
Disease | Graves' disease;KEGG DISEASE;H00082 |
Disease | psoriasis;GAD |
Disease | latex-fruit syndrome;GAD |
Disease | METABOLIC;GAD |
Disease | Schizophrenia;FunDO |
Disease | systemic lupus erythematosus;GAD |
Disease | Hashimoto's thyroiditis;KEGG DISEASE;H00081 |
Disease | tuberculosis;GAD |
Disease | diabetes, type 2;GAD |
Disease | Asthma;KEGG DISEASE;H00079 |
Disease | warts;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | pemphigus vulgaris;GAD |
Disease | rheumatoid arthritis;GAD |
Disease | narcolepsy;GAD |
Disease | IgE response;GAD |
Disease | Dilated cardiomyopathy (DCM);KEGG DISEASE;H00294 |
Disease | Narcolepsy;FunDO |
Disease | coronary artery ectasia;GAD |
Disease | latex allergy;GAD |
Disease | REPRODUCTION;GAD |
Disease | primary IgA nephropathy;GAD |
Disease | breast cancer;GAD |
Disease | Celiac disease;FunDO |
Disease | Systemic sclerosis;NHGRI |
Disease | Hodgkin's disease;FunDO |
Disease | stomach cancer;GAD |
Disease | Rheumatic fever;FunDO |
Disease | hepatitis type 2, autoimmune;GAD |
Disease | cirrhosis, biliary primary;GAD |
Disease | Hepatitis B, Chronic;GAD |
Disease | thyroiditis, Hashimoto's;GAD |
Disease | Myopia;GAD |
Disease | dermatomyositis/ polymyositis;GAD |
Disease | Stomach cancer;FunDO |
Disease | cataract glaucoma retinal detachment visual acuity Vogt-Koyanagi-Harada syndrome;GAD |
Disease | glutamic acid decarboxylase antibodies;GAD |
Disease | Sinusitis;GAD |
Disease | Creutzfeldt-Jakob disease, variant, resistance to;OMIM |
Disease | Circulatory system diseases;KEGG DISEASE |
Disease | VISION;GAD |
Disease | pancreatitis, chronic calcifying;GAD |
Disease | H. pylori infection;GAD |
Disease | Aplastic anemia;FunDO |
Disease | Asthma;GAD |
Disease | periodontitis;GAD |
Disease | Primary biliary cirrhosis;NHGRI |
Disease | Autoimmune disease;FunDO |
Disease | cholangitis, sclerosing;GAD |
Disease | Diabetes mellitus;FunDO |
Disease | diabetes-associated autoantibodies;GAD |
Disease | Vogt-Koyanagi-Harada syndrome;GAD |
Disease | Celiac Disease;GAD |
Disease | gastric adenocarcinoma;GAD |
Disease | Thalassemia;FunDO |
Disease | CANCER;GAD |
Disease | NEUROLOGICAL;GAD |
Disease | Lung Diseases;GAD |
Disease | sleepwalking;GAD |
Disease | Anemia, Sickle Cell;GAD |
Disease | papillomavirus infection;GAD |
Disease | pollen-induced allergic rhinitis;GAD |
Disease | Urticaria;GAD |
Disease | cervical cancer;GAD |
External Links | |
Links to Entrez Gene | 3119 |
Links to all GeneRIF Items | 3119 |
Links to iHOP | 3119 |
Sequence Information | |
Nucleotide Sequence | >3119 : length: 786 atgtcttggaagaaggctttgcggatccccggagaccttcgggtagcaactgtcaccttg atgctggcgatgctgagctccctactggctgagggcagagactctcccgaggatttcgtg ttccagtttaagggcatgtgctacttcaccaacgggacggagcgcgtgcgtcttgtgacc agatacatctataaccgagaggagtacgcgcgcttcgacagcgacgtgggggtgtaccgc gcggtgacgccgcaggggcggcctgatgccgagtactggaacagccagaaggaagtcctg gaggggacccgggcggagttggacacggtgtgcagacacaactacgaggtggcgttccgc gggatcttgcagaggagagtggagcccacagtgaccatctccccatccaggacagaggcc ctcaaccaccacaacctgctggtctgctcggtgacagatttctatccaggccagatcaaa gtccggtggtttcggaatgatcaggaggagacagccggcgttgtgtccaccccccttatt aggaatggtgactggactttccagatcctggtgatgctggaaatgactccccagcgtgga gatgtctacacctgccacgtggagcaccccagcctccagagccccatcaccgtggagtgg cgggctcagtctgaatctgcccagagcaagatgctgagtggcgttggaggcttcgtgctg gggctgatcttccttgggctgggccttatcatccgtcaaaggagtcagaaagggcttctg cactga |
Protein Sequence | >3119 : length: 261 MSWKKALRIPGDLRVATVTLMLAMLSSLLAEGRDSPEDFVFQFKGMCYFTNGTERVRLVT RYIYNREEYARFDSDVGVYRAVTPQGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFR GILQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLI RNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGVGGFVL GLIFLGLGLIIRQRSQKGLLH |