Entrez Gene

General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information
Gene ID	3123
Name	HLA-DRB1
Synonym	DRB1\|DRw10\|HLA-DR1B\|HLA-DRB\|SS1;major histocompatibility complex, class II, DR beta 1;HLA-DRB1;major histocompatibility complex, class II, DR beta 1
Definition	DW2.2/DR2.2\|HLA class II histocompatibility antigen, DR-1 beta chain\|MHC class II HLA-DR beta 1 chain\|MHC class II HLA-DR-beta cell surface glycoprotein\|MHC class II HLA-DRw10-beta\|MHC class II antigen\|human leucocyte antigen DRB1\|lymphocyte antigen DRB1
Position	6p21.3
Gene Type	protein-coding
PAH Type	Description
PAH	Association of clinical features with HLA in chronic pulmonary thromboembolism.
PAH	Association of HLA class II genes with idiopathic pulmonary arterial hypertension in Koreans.
PAH	HLA-DPB1 and NFKBIL1 may confer the susceptibility to chronic thromboembolic pulmonary hypertension in the absence of deep vein thrombosis.
	More detail of all Human literatures about HLA-DRB1
Pathways and Diseases
Pathway	Signaling in Immune system;Reactome;REACT:6900
Pathway	antigen processing and presentation;PID BioCarta;100107
Pathway	Allograft rejection;KEGG PATHWAY;hsa05330
Pathway	Cell adhesion molecules (CAMs);KEGG PATHWAY;hsa04514
Pathway	role of mef2d in t-cell apoptosis;PID BioCarta;100109
Pathway	Toxoplasmosis;KEGG PATHWAY;hsa05145
Pathway	Hematopoietic cell lineage;KEGG PATHWAY;hsa04640
Pathway	Systemic lupus erythematosus;KEGG PATHWAY;hsa05322
Pathway	Type I diabetes mellitus;KEGG PATHWAY;hsa04940
Pathway	activation of csk by camp-dependent protein kinase inhibits signaling through the t cell receptor;PID BioCarta;100196
Pathway	Antigen processing and presentation;KEGG PATHWAY;hsa04612
Pathway	t cell receptor signaling pathway;PID BioCarta;100022
Pathway	Phagosome;KEGG PATHWAY;hsa04145
Pathway	Intestinal immune network for IgA production;KEGG PATHWAY;hsa04672
Pathway	the co-stimulatory signal during t-cell activation;PID BioCarta;100193
Pathway	Viral myocarditis;KEGG PATHWAY;hsa05416
Pathway	Asthma;KEGG PATHWAY;hsa05310
Pathway	Staphylococcus aureus infection;KEGG PATHWAY;hsa05150
Pathway	lck and fyn tyrosine kinases in initiation of tcr activation;PID BioCarta;100023
Pathway	Graft-versus-host disease;KEGG PATHWAY;hsa05332
Pathway	Leishmaniasis;KEGG PATHWAY;hsa05140
Pathway	Autoimmune thyroid disease;KEGG PATHWAY;hsa05320
Disease	atopy;GAD
Disease	liver disease;GAD
Disease	Sjogren's syndrome;GAD
Disease	pollen allergy;GAD
Disease	recurrent respiratory papillomatosis;GAD
Disease	Diabetes;KEGG DISEASE
Disease	Multiple sclerosis;NHGRI
Disease	ocular cicatricial pemphigoid;GAD
Disease	Multiple sclerosis, susceptibility to;OMIM
Disease	IMMUNE;GAD
Disease	endometriosis;GAD
Disease	X-linked adrenoleukodystrophy;GAD
Disease	Cardiac diseases;KEGG DISEASE
Disease	INFECTION;GAD
Disease	Takayasu Arteritis;GAD
Disease	thryoiditis, chronic lymphocytic;GAD
Disease	cirrhosis, biliary primary;GAD
Disease	PSYCH;GAD
Disease	Pre-Eclampsia;GAD
Disease	alveolar echinococcosis;GAD
Disease	recurrent oral ulcers;GAD
Disease	(ANCA)-associated vasculitis;GAD
Disease	Mite-sensitive asthma;GAD
Disease	response to ximelagatran treatment;GAD
Disease	hepatitis, autoimmune;GAD
Disease	multiple sclerosis;GAD
Disease	Polyendocrinopathies, Autoimmune;GAD
Disease	sarcoidosis;GAD
Disease	hypertension, pulmonary arterial;GAD
Disease	Systemic lupus erythematosus;NHGRI
Disease	Syndrome;GAD
Disease	thyroiditis, Hashimoto's;GAD
Disease	pregnancy loss, recurrent;GAD
Disease	Immunoglobulin A;NHGRI
Disease	lymphoma;GAD
Disease	Graves' disease;GAD
Disease	narcolepsy;GAD
Disease	sickle cell anemia;GAD
Disease	rhinitis;GAD
Disease	hypertension;GAD
Disease	sclerosis, systemic;GAD
Disease	renal disease, end stage;GAD
Disease	thyroid disease, autoimmune;GAD
Disease	viral clearance;GAD
Disease	posttreatment Th2 immune response to S. mansoni Ags;GAD
Disease	Lumiracoxib-related liver injury;NHGRI
Disease	pemphigus foliaceus;GAD
Disease	diabetes, type 1;GAD
Disease	myasthenia gravis;GAD
Disease	Immune system diseases;KEGG DISEASE
Disease	preeclampsia;GAD
Disease	pancreatitis, autoimmune;GAD
Disease	Systemic lupus erythematosus;KEGG DISEASE;H00080
Disease	Rheumatoid arthritis;NHGRI
Disease	Crohn's disease;GAD
Disease	epilepsy;GAD
Disease	hypothyroidism, goitrous juvenile autoimmune;GAD
Disease	vitiligo;GAD
Disease	human papillomavirus infection;GAD
Disease	Type I diabetes mellitus;KEGG DISEASE;H00408
Disease	Azoospermia;GAD
Disease	schizophrenia;GAD
Disease	SLE;GAD
Disease	Allergies and autoimmune diseases;KEGG DISEASE
Disease	Autism;GAD
Disease	ulcerative colitis;GAD
Disease	HEMATOLOGICAL;GAD
Disease	Arthritis, Rheumatoid;GAD
Disease	alpha 1-Antitrypsin Deficiency;GAD
Disease	allergy;GAD
Disease	rheumatic heart disease;GAD
Disease	Multiple Myeloma;GAD
Disease	birth weight body mass;GAD
Disease	pulmonary tuberculosis;GAD
Disease	increased prevalence and level of insulin autoantibodies;GAD
Disease	Addison's disease;GAD
Disease	Graves' disease;KEGG DISEASE;H00082
Disease	psoriasis;GAD
Disease	PHARMACOGENOMIC;GAD
Disease	METABOLIC;GAD
Disease	lupus erythematosus;GAD
Disease	rheumatoid arthritis;GAD
Disease	systemic lupus erythematosus;GAD
Disease	Response to ximelagatran treatment;NHGRI
Disease	Hashimoto's thyroiditis;KEGG DISEASE;H00081
Disease	tuberculosis;GAD
Disease	diabetes, type 2;GAD
Disease	Arthritis (juvenile idiopathic);GAD
Disease	Asthma;KEGG DISEASE;H00079
Disease	CARDIOVASCULAR;GAD
Disease	Vogt-Koyanagi-Harada's disease;GAD
Disease	Dilated cardiomyopathy (DCM);KEGG DISEASE;H00294
Disease	coronary artery ectasia;GAD
Disease	REPRODUCTION;GAD
Disease	Metabolic diseases;KEGG DISEASE
Disease	autologous mixed lymphocyte reaction;GAD
Disease	breast cancer;GAD
Disease	Diabetes Mellitus;GAD
Disease	SPT (cockroach);GAD
Disease	thyroid carcinoma;GAD
Disease	autoimmune thyroid disease;GAD
Disease	Type 1 diabetes;NHGRI
Disease	Alzheimer's disease;GAD
Disease	Hepatitis B, Chronic;GAD
Disease	blood group incompatibility;GAD
Disease	Rheumatoid arthritis, susceptibility to;OMIM
Disease	Graves disease;GAD
Disease	hepatitis type 2, autoimmune;GAD
Disease	Arthritis (juvenile idiopathic);NHGRI
Disease	antineutrophil cytoplasmic antibody;GAD
Disease	immune response to hepatitis B vaccine;GAD
Disease	Circulatory system diseases;KEGG DISEASE
Disease	VISION;GAD
Disease	nephropathy in other diseases;GAD
Disease	pancreatitis, chronic calcifying;GAD
Disease	aortoarteritis;GAD
Disease	delayed sleep phase syndrome.;GAD
Disease	Asthma;GAD
Disease	periodontitis;GAD
Disease	psoriatic arthritis;GAD
Disease	Lung Diseases;GAD
Disease	cholangitis, sclerosing;GAD
Disease	Vogt-Koyanagi-Harada syndrome;GAD
Disease	Pemphigoid, susceptibility to;OMIM
Disease	Celiac Disease;GAD
Disease	gastric adenocarcinoma;GAD
Disease	CANCER;GAD
Disease	SPT (HDM);GAD
Disease	giant cell arteritis;GAD
Disease	NEUROLOGICAL;GAD
Disease	microscopic polyangiitis;GAD
Disease	leukemia;GAD
Disease	type 1 diabetes;GAD
Disease	Anemia, Sickle Cell;GAD
Disease	cardiomyopathy;GAD
Disease	Sarcoidosis, susceptibility l, 1;OMIM
Disease	Urticaria;GAD
Disease	cervical cancer;GAD
External Links
Links to Entrez Gene	3123
Links to all GeneRIF Items	3123
Links to iHOP	3123
Sequence Information
Nucleotide Sequence	>3123 : length: 801 atggtgtgtctgaagctccctggaggctcctgcatgacagcgctgacagtgacactgatg gtgctgagctccccactggctttgtctggggacacccgaccacgtttcctgtggcagcct aagagggagtgtcatttcttcaatgggacggagcgggtgcggttcctggacagatacttc tataaccaggaggagtccgtgcgcttcgacagcgacgtgggggagttccgggcggtgacg gagctggggcggcctgacgctgagtactggaacagccagaaggacatcctggagcaggcg cgggccgcggtggacacctactgcagacacaactacggggttgtggagagcttcacagtg cagcggcgagtccaacctaaggtgactgtatatccttcaaagacccagcccctgcagcac cacaacctcctggtctgctctgtgagtggtttctatccaggcagcattgaagtcaggtgg ttcctgaacggccaggaagagaaggctgggatggtgtccacaggcctgatccagaatgga gactggaccttccagaccctggtgatgctggaaacagttcctcgaagtggagaggtttac acctgccaagtggagcacccaagcgtgacaagccctctcacagtggaatggagagcacgg tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc ttccttggggccgggctgttcatctacttcaggaatcagaaaggacactctggacttcag ccaacaggattcctgagctga
Protein Sequence	>3123 : length: 266 MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYF YNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTV QRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNG DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL FLGAGLFIYFRNQKGHSGLQPTGFLS