| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 3383 |
Name | ICAM1 |
Synonym | BB2|CD54|P3.58;intercellular adhesion molecule 1;ICAM1;intercellular adhesion molecule 1 |
Definition | ICAM-1|cell surface glycoprotein P3.58|intercellular adhesion molecule 1 (CD54), human rhinovirus receptor|major group rhinovirus receptor |
Position | 19p13.3-p13.2 |
Gene Type | protein-coding |
PAH Type | Description |
PAH | "Real-time quantitative PCR confirmed increased expression of 9 genes (ICAM1, IFNGR1, IL1B, IL13Ra1, JAK2, AIF1, CCR1, ALAS2, TIMP2) in lSSc-PAH patients. Increased circulating cytokine levels of inflammatory mediators such as TNF-alpha, IL1-beta, ICAM-1, and IL-6, and markers of vascular injury such as VCAM-1, VEGF, and von Willebrand Factor were found in lSSc-PAH subjects." |
| More detail of all Human literatures about ICAM1 | |
Pathways and Diseases | |
Pathway | Signaling in Immune system;Reactome;REACT:6900 |
Pathway | Malaria;KEGG PATHWAY;hsa05144 |
Pathway | Glucocorticoid receptor regulatory network;PID Curated;200077 |
Pathway | Viral myocarditis;KEGG PATHWAY;hsa05416 |
Pathway | Staphylococcus aureus infection;KEGG PATHWAY;hsa05150 |
Pathway | Thromboxane A2 receptor signaling;PID Curated;200069 |
Pathway | Cell adhesion molecules (CAMs);KEGG PATHWAY;hsa04514 |
Pathway | Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670 |
Pathway | Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650 |
Pathway | Integrin cell surface interactions;Reactome;REACT:13552 |
Pathway | amb2 Integrin signaling;PID Curated;200108 |
Disease | inflammatory bowel disease;GAD |
Disease | Kaposi sarcoma;FunDO |
Disease | Thromboangiitis obliterans;FunDO |
Disease | Bronchiolitis;FunDO |
Disease | Influenza;FunDO |
Disease | IMMUNE;GAD |
Disease | Schistosoma mansonii infection;FunDO |
Disease | HEMATOLOGICAL;GAD |
Disease | hematology indices;GAD |
Disease | Inflammation of the central nervous system;FunDO |
Disease | INFECTION;GAD |
Disease | Colon cancer;FunDO |
Disease | Glomerulonephritis, IGA;GAD |
Disease | PSYCH;GAD |
Disease | Alopecia;FunDO |
Disease | renal scarring urinary tract infection;GAD |
Disease | Malaria;FunDO |
Disease | Graves' disease;FunDO |
Disease | diabetes, type 1 diabetic nephropathy;GAD |
Disease | Enteritis;FunDO |
Disease | Soluble ICAM-1;NHGRI |
Disease | myocardial infarct;GAD |
Disease | dementia, vascular;GAD |
Disease | Atherosclerosis;FunDO |
Disease | Lupus erythematosus;FunDO |
Disease | Vasculitis;FunDO |
Disease | Tuberous sclerosis;FunDO |
Disease | Graves' disease;GAD |
Disease | Intraocular melanoma;FunDO |
Disease | Migraine;FunDO |
Disease | Pertussis;FunDO |
Disease | Biliary Atresia;FunDO |
Disease | Melanoma;FunDO |
Disease | Liver cancer;FunDO |
Disease | Ulcerative colitis;FunDO |
Disease | Herpes;FunDO |
Disease | coronary heart disease, transplant associated;GAD |
Disease | atherosclerosis, coronary;GAD |
Disease | coronary heart disease;GAD |
Disease | Systemic infection;FunDO |
Disease | diabetes, type 1;GAD |
Disease | Hyperinsulinism;FunDO |
Disease | malaria;GAD |
Disease | Crohn's disease;GAD |
Disease | Brain tumor;FunDO |
Disease | Behcet syndrome;FunDO |
Disease | Osteoporosis;FunDO |
Disease | Heart disease;FunDO |
Disease | Allergies and autoimmune diseases;KEGG DISEASE |
Disease | ulcerative colitis;GAD |
Disease | Thyroiditis;FunDO |
Disease | Sicca syndrome;FunDO |
Disease | Macular degeneration;FunDO |
Disease | Urinary tract infection;FunDO |
Disease | Atopic rhinitis;FunDO |
Disease | Asthma;FunDO |
Disease | Nervous system disease;FunDO |
Disease | HIV infection;FunDO |
Disease | Neoplasm metastasis;FunDO |
Disease | Prostate cancer;FunDO |
Disease | Rheumatic fever;FunDO |
Disease | Leukemia;FunDO |
Disease | Dental plaque;FunDO |
Disease | Allograft rejection;KEGG DISEASE;H00083 |
Disease | retinopathy, diabetic;GAD |
Disease | METABOLIC;GAD |
Disease | Pre-Eclampsia;FunDO |
Disease | diabetes, type 2;GAD |
Disease | Tuberculosis;FunDO |
Disease | CARDIOVASCULAR;GAD |
Disease | Schizophrenia;FunDO |
Disease | Spinal cord disease;FunDO |
Disease | Labor, Premature;FunDO |
Disease | Lung cancer;FunDO |
Disease | Chronic obstructive airway disease;FunDO |
Disease | Behcets disease;GAD |
Disease | Immune system diseases;KEGG DISEASE |
Disease | Celiac disease;FunDO |
Disease | Obesity;FunDO |
Disease | Pemphigoid, Bullous;FunDO |
Disease | Multiple system atrophy;FunDO |
Disease | Bladder cancer;FunDO |
Disease | Pseudoxanthoma elasticum;FunDO |
Disease | Alzheimer's disease;GAD |
Disease | soluble ICAM-1;GAD |
Disease | arthritis;GAD |
Disease | Breast cancer;FunDO |
Disease | Stomach cancer;FunDO |
Disease | vascular dementia;GAD |
Disease | Cystic fibrosis;FunDO |
Disease | VISION;GAD |
Disease | Rheumatoid arthritis;FunDO |
Disease | Stroke;FunDO |
Disease | Yersinia infection;FunDO |
Disease | Alzheimer's disease;FunDO |
Disease | Primary biliary cirrhosis;FunDO |
Disease | bone density;GAD |
Disease | Diabetes mellitus;FunDO |
Disease | Malaria, cerebral, susceptibility to;OMIM |
Disease | Celiac Disease;GAD |
Disease | transplant associated vasculopathy after cardiac transplantation;GAD |
Disease | Multiple sclerosis;FunDO |
Disease | Myocardial Infarction;GAD |
Disease | Hemorrhagic fevers, Viral;FunDO |
Disease | Kidney failure;FunDO |
Disease | Endometriosis;FunDO |
Disease | NEUROLOGICAL;GAD |
Disease | Hodgkin's disease;FunDO |
Disease | Glucose intolerance;FunDO |
Disease | RENAL;GAD |
External Links | |
Links to Entrez Gene | 3383 |
Links to all GeneRIF Items | 3383 |
Links to iHOP | 3383 |
Sequence Information | |
Nucleotide Sequence | >3383 : length: 1599 atggctcccagcagcccccggcccgcgctgcccgcactcctggtcctgctcggggctctg ttcccaggacctggcaatgcccagacatctgtgtccccctcaaaagtcatcctgccccgg ggaggctccgtgctggtgacatgcagcacctcctgtgaccagcccaagttgttgggcata gagaccccgttgcctaaaaaggagttgctcctgcctgggaacaaccggaaggtgtatgaa ctgagcaatgtgcaagaagatagccaaccaatgtgctattcaaactgccctgatgggcag tcaacagctaaaaccttcctcaccgtgtactggactccagaacgggtggaactggcaccc ctcccctcttggcagccagtgggcaagaaccttaccctacgctgccaggtggagggtggg gcaccccgggccaacctcaccgtggtgctgctccgtggggagaaggagctgaaacgggag ccagctgtgggggagcccgctgaggtcacgaccacggtgctggtgaggagagatcaccat ggagccaatttctcgtgccgcactgaactggacctgcggccccaagggctggagctgttt gagaacacctcggccccctaccagctccagacctttgtcctgccagcgactcccccacaa cttgtcagcccccgggtcctagaggtggacacgcaggggaccgtggtctgttccctggac gggctgttcccagtctcggaggcccaggtccacctggcactgggggaccagaggttgaac cccacagtcacctatggcaacgactccttctcggccaaggcctcagtcagtgtgaccgca gaggacgagggcacccagcggctgacgtgtgcagtaatactggggaaccagagccaggag acactgcagacagtgaccatctacagctttccggcgcccaacgtgattctgacgaagcca gaggtctcagaagggaccgaggtgacagtgaagtgtgaggcccaccctagagccaaggtg acgctgaatggggttccagcccagccactgggcccgagggcccagctcctgctgaaggcc accccagaggacaacgggcgcagcttctcctgctctgcaaccctggaggtggccggccag cttatacacaagaaccagacccgggagcttcgtgtcctgtatggcccccgactggacgag agggattgtccgggaaactggacgtggccagaaaattcccagcagactccaatgtgccag gcttgggggaacccattgcccgagctcaagtgtctaaaggatggcactttcccactgccc atcggggaatcagtgactgtcactcgagatcttgagggcacctacctctgtcgggccagg agcactcaaggggaggtcacccgcaaggtgaccgtgaatgtgctctccccccggtatgag attgtcatcatcactgtggtagcagccgcagtcataatgggcactgcaggcctcagcacg tacctctataaccgccagcggaagatcaagaaatacagactacaacaggcccaaaaaggg acccccatgaaaccgaacacacaagccacgcctccctga |
Protein Sequence | >3383 : length: 532 MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGI ETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHH GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKA TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP |