| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 3552 |
Name | IL1A |
Synonym | IL-1A|IL1|IL1-ALPHA|IL1F1;interleukin 1, alpha;IL1A;interleukin 1, alpha |
Definition | IL-1 alpha|hematopoietin-1|interleukin-1 alpha|preinterleukin 1 alpha|pro-interleukin-1-alpha |
Position | 2q14 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | Constitutive expression of interleukin-1alpha precursor promotes human vascular smooth muscle cell proliferation. |
| More detail of all Human literatures about IL1A | |
|
Pathways and Diseases |
|
Pathway | Signaling in Immune system;Reactome;REACT:6900 |
Pathway | Type I diabetes mellitus;KEGG PATHWAY;hsa04940 |
Pathway | a6b1 and a6b4 Integrin signaling;PID Curated;200162 |
Pathway | Prion diseases;KEGG PATHWAY;hsa05020 |
Pathway | Apoptosis;KEGG PATHWAY;hsa04210 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | signal transduction through il1r;PID BioCarta;100132 |
Pathway | MAPK signaling pathway;KEGG PATHWAY;hsa04010 |
Pathway | stress induction of hsp regulation;PID BioCarta;100142 |
Pathway | IL1-mediated signaling events;PID Curated;200075 |
Pathway | Hematopoietic cell lineage;KEGG PATHWAY;hsa04640 |
Pathway | Graft-versus-host disease;KEGG PATHWAY;hsa05332 |
Pathway | gata3 participate in activating the th2 cytokine genes expression;PID BioCarta;100157 |
Pathway | il-10 anti-inflammatory signaling pathway;PID BioCarta;100134 |
Pathway | Leishmaniasis;KEGG PATHWAY;hsa05140 |
Pathway | nf-kb signaling pathway;PID BioCarta;100097 |
Pathway | Interleukin signaling pathway;PANTHER;P00036 |
Disease | Scleroderma;FunDO |
Disease | atopy;GAD |
Disease | Osteoporosis;FunDO |
Disease | Severe Malaria;GAD |
Disease | H. pylori infection;GAD |
Disease | preterm delivery;GAD |
Disease | Alzheimer's disease;GAD |
Disease | Migraine;FunDO |
Disease | Periodontitis;FunDO |
Disease | Hepatitis C;FunDO |
Disease | sepsis;GAD |
Disease | arthritis;GAD |
Disease | migraine;GAD |
Disease | Hamman-Rich syndrome;FunDO |
Disease | Stomach cancer;FunDO |
Disease | Glaucoma;FunDO |
Disease | rhinitis;GAD |
Disease | Herpes;FunDO |
Disease | Embryoma;FunDO |
Disease | Type 2 Diabetes related glucose homeostasis trait;GAD |
Disease | Cystic fibrosis;FunDO |
Disease | Endometriosis;NHGRI |
Disease | IMMUNE;GAD |
Disease | Systemic scleroderma;FunDO |
Disease | meningococcal disease;GAD |
Disease | Rheumatoid arthritis;FunDO |
Disease | gingival bleeding gingivitis;GAD |
Disease | Leukemia;FunDO |
Disease | Polycystic ovary syndrome;FunDO |
Disease | METABOLIC;GAD |
Disease | periodontitis;GAD |
Disease | Schizophrenia;FunDO |
Disease | Infertility;FunDO |
Disease | Cerebral Infarction;GAD |
Disease | Cervical cancer;FunDO |
Disease | pneumoconiosis, coal workers';GAD |
Disease | Gastritis;FunDO |
Disease | Tuberculosis;FunDO |
Disease | Diabetes mellitus;FunDO |
Disease | Behcet's Disease;GAD |
Disease | myasthenia gravis;GAD |
Disease | systemic sclerosis;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | Endometrium cancer;FunDO |
Disease | osteoarthritis;GAD |
Disease | Bladder cancer;FunDO |
Disease | Kidney failure;FunDO |
Disease | Liver metastases;FunDO |
Disease | knee osteoarthritis;GAD |
Disease | Endometriosis;FunDO |
Disease | INFECTION;GAD |
Disease | NEUROLOGICAL;GAD |
Disease | Hyperglycemia;FunDO |
Disease | REPRODUCTION;GAD |
Disease | Behcet syndrome;FunDO |
Disease | Graft-versus-host disease;KEGG DISEASE;H00084 |
Disease | periodontal disease;GAD |
Disease | cerebral amyloid angiopathy-related hemorrhage.;GAD |
Disease | Alzheimer's disease;FunDO |
Disease | Pancreas cancer;FunDO |
Disease | Immune system diseases;KEGG DISEASE |
Disease | Skin disease;FunDO |
Disease | Ovarian cancer;FunDO |
Disease | high interleukin-1 beta plasma levels;GAD |
Disease | Allergies and autoimmune diseases;KEGG DISEASE |
Disease | Arthritis;FunDO |
Disease | Atherosclerosis;FunDO |
|
External Links |
|
Links to Entrez Gene | 3552 |
Links to all GeneRIF Items | 3552 |
Links to iHOP | 3552 |
|
Sequence Information |
|
Nucleotide Sequence |
>3552 : length: 816 atggccaaagttccagacatgtttgaagacctgaagaactgttacagtgaaaatgaagaa gacagttcctccattgatcatctgtctctgaatcagaaatccttctatcatgtaagctat ggcccactccatgaaggctgcatggatcaatctgtgtctctgagtatctctgaaacctct aaaacatccaagcttaccttcaaggagagcatggtggtagtagcaaccaacgggaaggtt ctgaagaagagacggttgagtttaagccaatccatcactgatgatgacctggaggccatc gccaatgactcagaggaagaaatcatcaagcctaggtcagcaccttttagcttcctgagc aatgtgaaatacaactttatgaggatcatcaaatacgaattcatcctgaatgacgccctc aatcaaagtataattcgagccaatgatcagtacctcacggctgctgcattacataatctg gatgaagcagtgaaatttgacatgggtgcttataagtcatcaaaggatgatgctaaaatt accgtgattctaagaatctcaaaaactcaattgtatgtgactgcccaagatgaagaccaa ccagtgctgctgaaggagatgcctgagatacccaaaaccatcacaggtagtgagaccaac ctcctcttcttctgggaaactcacggcactaagaactatttcacatcagttgcccatcca aacttgtttattgccacaaagcaagactactgggtgtgcttggcaggggggccaccctct atcactgactttcagatactggaaaaccaggcgtag |
Protein Sequence |
>3552 : length: 271 MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETS KTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLS NVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKI TVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHP NLFIATKQDYWVCLAGGPPSITDFQILENQA |