| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 3569 |
Name | IL6 |
Synonym | BSF2|HGF|HSF|IFNB2|IL-6;interleukin 6 (interferon, beta 2);IL6;interleukin 6 (interferon, beta 2) |
Definition | B-cell differentiation factor|B-cell stimulatory factor 2|BSF-2|CDF|CTL differentiation factor|IFN-beta-2|hybridoma growth factor|interferon beta-2|interleukin BSF-2|interleukin-6 |
Position | 7p21 |
Gene Type | protein-coding |
PAH Type | Description |
PAH | "In conclusion, BMC transfusion appears to improve survival rate, RVH, and mean RV pressure, and decreases gene expressions of ET-1, ERA, NOS 3, MMP 2, TIMP, IL-6, and TNF-alpha." |
PAH | "In conclusion, BMC transfusion appears to improve survival rate, RVH, and mean RV pressure, and decreases gene expressions of ET-1, ERA, NOS 3, MMP 2, TIMP, IL-6, and TNF-alpha." |
| More detail of all Rat literatures about IL6 | |
Pathways and Diseases | |
Pathway | Glucocorticoid receptor regulatory network;PID Curated;200077 |
Pathway | role of erbb2 in signal transduction and oncology;PID BioCarta;100147 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | ATF-2 transcription factor network;PID Curated;200116 |
Pathway | LPA receptor mediated events;PID Curated;200011 |
Pathway | Amoebiasis;KEGG PATHWAY;hsa05146 |
Pathway | IL27-mediated signaling events;PID Curated;200023 |
Pathway | NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621 |
Pathway | Hematopoietic cell lineage;KEGG PATHWAY;hsa04640 |
Pathway | Hypertrophic cardiomyopathy (HCM);KEGG PATHWAY;hsa05410 |
Pathway | Cytosolic DNA-sensing pathway;KEGG PATHWAY;hsa04623 |
Pathway | Malaria;KEGG PATHWAY;hsa05144 |
Pathway | signal transduction through il1r;PID BioCarta;100132 |
Pathway | Graft-versus-host disease;KEGG PATHWAY;hsa05332 |
Pathway | AP-1 transcription factor network;PID Curated;200118 |
Pathway | Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044 |
Pathway | il-10 anti-inflammatory signaling pathway;PID BioCarta;100134 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Intestinal immune network for IgA production;KEGG PATHWAY;hsa04672 |
Pathway | Chagas disease;KEGG PATHWAY;hsa05142 |
Pathway | Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630 |
Pathway | Prion diseases;KEGG PATHWAY;hsa05020 |
Pathway | Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620 |
Pathway | IL23-mediated signaling events;PID Curated;200131 |
Pathway | il 6 signaling pathway;PID BioCarta;100126 |
Pathway | IL6-mediated signaling events;PID Curated;200124 |
Pathway | Interleukin signaling pathway;PANTHER;P00036 |
Pathway | amb2 Integrin signaling;PID Curated;200108 |
Disease | atopy;GAD |
Disease | renal transplantation, rejection after;GAD |
Disease | Cardiovascular disease;FunDO |
Disease | hepatitis C infection;GAD |
Disease | leukemia virus type I;GAD |
Disease | Nasopharyngeal cancer;FunDO |
Disease | Brain aging;GAD |
Disease | Henoch-Schoenlein purpura;FunDO |
Disease | Metabolism disease;FunDO |
Disease | longevity;GAD |
Disease | bone loss;GAD |
Disease | Sudden infant death syndrome;FunDO |
Disease | IMMUNE;GAD |
Disease | Parkinson's disease;GAD |
Disease | glucose;GAD |
Disease | Alopecia;FunDO |
Disease | Polycystic ovary syndrome;FunDO |
Disease | Diabetes, susceptibility to;OMIM |
Disease | INFECTION;GAD |
Disease | levels of antibodies to 60-kDa heat-shock proteins;GAD |
Disease | Cervical cancer;FunDO |
Disease | Larynx cancer;FunDO |
Disease | hepatitis B;GAD |
Disease | Bone Resorption;GAD |
Disease | cirrhosis, biliary primary;GAD |
Disease | Hamman-Rich syndrome;FunDO |
Disease | Renal Cell cancer;FunDO |
Disease | Subacute sclerosing panencephalitis;FunDO |
Disease | Tropical spastic paraparesis;FunDO |
Disease | insulin sensitivity;GAD |
Disease | Basal cell carcinoma;FunDO |
Disease | long-term kidney allograft survival;GAD |
Disease | Birth Weight;GAD |
Disease | Cerebral palsy;FunDO |
Disease | multiple sclerosis;GAD |
Disease | Enteritis;FunDO |
Disease | Lupus vulgaris;FunDO |
Disease | C-reactive protein;GAD |
Disease | papillary thyroid carcinoma;GAD |
Disease | Waldenstrom macroglobulinaemia;GAD |
Disease | Infertility;FunDO |
Disease | myocardial infarct;GAD |
Disease | Bone Mineralization;GAD |
Disease | Obsessive-compulsive disorder;FunDO |
Disease | Bone Mineral Density;GAD |
Disease | Insulin Resistance;GAD |
Disease | breast cancer;GAD |
Disease | Respiratory distress syndrome;FunDO |
Disease | Kaposi sarcoma, susceptibility to;OMIM |
Disease | Migraine;FunDO |
Disease | Lung cancer;FunDO |
Disease | Septicemia;FunDO |
Disease | Ulcerative colitis;FunDO |
Disease | Hypercholesterolemia;FunDO |
Disease | ageing;GAD |
Disease | Dermatitis;FunDO |
Disease | Amnionitis;FunDO |
Disease | Fatty Liver;GAD |
Disease | subclinical carotid atherosclerosis;GAD |
Disease | HTLV-I infection;FunDO |
Disease | kidney transplant;GAD |
Disease | coronary heart disease;GAD |
Disease | Systemic infection;FunDO |
Disease | postoperative systemic inflammatory reaction;GAD |
Disease | body mass;GAD |
Disease | METABOLIC;GAD |
Disease | sepsis;GAD |
Disease | pneumoconiosis, coal workers' silicosis;GAD |
Disease | diabetes, type 1;GAD |
Disease | Thrombocytopenia;FunDO |
Disease | Intracranial aneurysm;FunDO |
Disease | stroke, hemorrhagic stroke, ischemic;GAD |
Disease | Inflamatory Bowel disease;GAD |
Disease | Kidney Failure, Chronic;GAD |
Disease | Crohn Disease;GAD |
Disease | Endometrial cancer;FunDO |
Disease | Uterine fibroids;FunDO |
Disease | Adrenal gland tumor;FunDO |
Disease | Brain tumor;FunDO |
Disease | Graft-versus-host disease;KEGG DISEASE;H00084 |
Disease | IGA glomerulonephritis;FunDO |
Disease | systemic juvenile idiopathic arthritis;GAD |
Disease | Abortion;FunDO |
Disease | elite athletes;GAD |
Disease | Ovarian cancer;FunDO |
Disease | Heart disease;FunDO |
Disease | Allergies and autoimmune diseases;KEGG DISEASE |
Disease | Infection;GAD |
Disease | Hyperandrogenism;GAD |
Disease | Hemorrhagic fevers, Viral;FunDO |
Disease | Respiratory Distress Syndrome, Adult;GAD |
Disease | Arteriopathy;FunDO |
Disease | Bone metastases;FunDO |
Disease | Hyperglycemia;FunDO |
Disease | AGING;GAD |
Disease | Mental Retardation;GAD |
Disease | Prostate cancer;FunDO |
Disease | Anemia;FunDO |
Disease | Leukemia;FunDO |
Disease | Down syndrome;FunDO |
Disease | Dental plaque;FunDO |
Disease | Rheumatoid arthritis, systemic juvenile;OMIM |
Disease | rheumatoid arthritis;GAD |
Disease | disc disease, intervertebral;GAD |
Disease | leptin;GAD |
Disease | colorectal cancer;GAD |
Disease | appendicitis;GAD |
Disease | diabetes, type 2;GAD |
Disease | Bronchiolitis obliterans;FunDO |
Disease | Coronary Artery Disease;GAD |
Disease | Keratoconjunctivitis Sicca;FunDO |
Disease | Leukomalacia, Periventricular;GAD |
Disease | Glomerulonephritis;FunDO |
Disease | Brucellosis;FunDO |
Disease | neonatal infection;GAD |
Disease | Chronic obstructive airway disease;FunDO |
Disease | Alimentary system disease;FunDO |
Disease | REPRODUCTION;GAD |
Disease | atherosclerosis, coronary lipids lipoprotein;GAD |
Disease | Malnutrition;FunDO |
Disease | periodontal disease;GAD |
Disease | Esophagitis;FunDO |
Disease | Immune system diseases;KEGG DISEASE |
Disease | graft versus host disease;GAD |
Disease | Obesity;FunDO |
Disease | Anorexia nervosa;FunDO |
Disease | bronchiolitis obliterans syndrome;GAD |
Disease | Atherosclerosis;GAD |
Disease | Type 2 diabtes;GAD |
Disease | intima-media thickness, carotid;GAD |
Disease | Neuroendocrine tumor;FunDO |
Disease | preterm delivery;GAD |
Disease | lipids;GAD |
Disease | Hepatitis C;FunDO |
Disease | obesity;GAD |
Disease | trypanosomiasis;GAD |
Disease | Breast cancer;FunDO |
Disease | Inflammation;GAD |
Disease | Leukoencephalopathy;FunDO |
Disease | Embryoma;FunDO |
Disease | vascular disease;GAD |
Disease | SIDS/sudden infant death syndrome;GAD |
Disease | Liver disease;FunDO |
Disease | Yersinia infection;FunDO |
Disease | coronary artery spasm;GAD |
Disease | Alzheimer's disease;FunDO |
Disease | Autoimmune disease;FunDO |
Disease | bone density;GAD |
Disease | Adenoma;FunDO |
Disease | Celiac Disease;GAD |
Disease | Chorioamnionitis;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | Thalassemia;FunDO |
Disease | CANCER;GAD |
Disease | Lyme disease;FunDO |
Disease | Kidney failure;FunDO |
Disease | Endometriosis;FunDO |
Disease | NEUROLOGICAL;GAD |
Disease | Hodgkin lymphoma;GAD |
Disease | Renal tubular acidosis;FunDO |
Disease | Generalized anxiety disorder;FunDO |
Disease | Intracranial hemorrhage in brain cerebrovascular malformations, susceptibility to;OMIM |
Disease | Thrombocytosis;FunDO |
Disease | bacterial vaginosis;GAD |
Disease | Barrett's esophagus;FunDO |
Disease | Pituitary tumor;FunDO |
Disease | Severe acute respiratory syndrome;FunDO |
Disease | Crohn disease-associated growth failure;OMIM |
Disease | Lupus;GAD |
Disease | Cushing syndrome;FunDO |
Disease | RENAL;GAD |
External Links | |
Links to Entrez Gene | 3569 |
Links to all GeneRIF Items | 3569 |
Links to iHOP | 3569 |
Sequence Information | |
Nucleotide Sequence | >3569 : length: 639 atgaactccttctccacaagcgccttcggtccagttgccttctccctggggctgctcctg gtgttgcctgctgccttccctgccccagtacccccaggagaagattccaaagatgtagcc gccccacacagacagccactcacctcttcagaacgaattgacaaacaaattcggtacatc ctcgacggcatctcagccctgagaaaggagacatgtaacaagagtaacatgtgtgaaagc agcaaagaggcactggcagaaaacaacctgaaccttccaaagatggctgaaaaagatgga tgcttccaatctggattcaatgaggagacttgcctggtgaaaatcatcactggtcttttg gagtttgaggtatacctagagtacctccagaacagatttgagagtagtgaggaacaagcc agagctgtgcagatgagtacaaaagtcctgatccagttcctgcagaaaaaggcaaagaat ctagatgcaataaccacccctgacccaaccacaaatgccagcctgctgacgaagctgcag gcacagaaccagtggctgcaggacatgacaactcatctcattctgcgcagctttaaggag ttcctgcagtccagcctgagggctcttcggcaaatgtag |
Protein Sequence | >3569 : length: 212 MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |