| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 3627 |
Name | CXCL10 |
Synonym | C7|IFI10|INP10|IP-10|SCYB10|crg-2|gIP-10|mob-1;chemokine (C-X-C motif) ligand 10;CXCL10;chemokine (C-X-C motif) ligand 10 |
Definition | 10 kDa interferon gamma-induced protein|C-X-C motif chemokine 10|gamma IP10|gamma-IP10|interferon-inducible cytokine IP-10|protein 10 from interferon (gamma)-induced cell line|small inducible cytokine subfamily B (Cys-X-Cys), member 10|small-inducible cyt |
Position | 4q21 |
Gene Type | protein-coding |
PAH Type | Description |
PAH | CXC-chemokine ligand 10 in idiopathic pulmonary arterial hypertension: marker of improved survival. |
| More detail of all Human literatures about CXCL10 | |
Pathways and Diseases | |
Pathway | Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620 |
Pathway | Signaling by GPCR;Reactome;REACT:14797 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | RIG-I-like receptor signaling pathway;KEGG PATHWAY;hsa04622 |
Pathway | Chemokine signaling pathway;KEGG PATHWAY;hsa04062 |
Pathway | Cytosolic DNA-sensing pathway;KEGG PATHWAY;hsa04623 |
Pathway | Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031 |
Pathway | CXCR3-mediated signaling events;PID Curated;200150 |
Disease | Autoimmune disease;FunDO |
Disease | Primary biliary cirrhosis;FunDO |
Disease | Hypothyroidism;FunDO |
Disease | Pre-Eclampsia;FunDO |
Disease | Pancreatitis;FunDO |
Disease | Chronic rejection of renal transplant;FunDO |
Disease | Infection;FunDO |
Disease | Prostate cancer;FunDO |
Disease | Uterine cancer;FunDO |
Disease | Asthma;FunDO |
Disease | Ulcerative colitis;FunDO |
Disease | Thyroid gland disease;FunDO |
Disease | Liver disease;FunDO |
Disease | Systemic infection;FunDO |
Disease | Hepatitis C;FunDO |
Disease | Chronic obstructive airway disease;FunDO |
Disease | Atherosclerosis;FunDO |
External Links | |
Links to Entrez Gene | 3627 |
Links to all GeneRIF Items | 3627 |
Links to iHOP | 3627 |
Sequence Information | |
Nucleotide Sequence | >3627 : length: 297 atgaatcaaactgccattctgatttgctgccttatctttctgactctaagtggcattcaa ggagtacctctctctagaactgtacgctgtacctgcatcagcattagtaatcaacctgtt aatccaaggtctttagaaaaacttgaaattattcctgcaagccaattttgtccacgtgtt gagatcattgctacaatgaaaaagaagggtgagaagagatgtctgaatccagaatcgaag gccatcaagaatttactgaaagcagttagcaaggaaaggtctaaaagatctccttaa |
Protein Sequence | >3627 : length: 98 MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRV EIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |