| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 3952 |
Name | LEP |
Synonym | LEPD|OB|OBS;leptin;LEP;leptin |
Definition | leptin (murine obesity homolog)|leptin (obesity homolog, mouse)|obese protein|obese, mouse, homolog of|obesity factor |
Position | 7q31.3 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | Findings indicate that serum leptin was higher in idiopathic pulmonary arterial hypertension and scleroderma-associated pulmonary arterial hypertension patients than controls. |
| More detail of all Human literatures about LEP | |
|
Pathways and Diseases |
|
Pathway | Adipocytokine signaling pathway;KEGG PATHWAY;hsa04920 |
Pathway | Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630 |
Pathway | reversal of insulin resistance by leptin;PID BioCarta;100117 |
Pathway | Signaling events mediated by PTP1B;PID Curated;200033 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | Neuroactive ligand-receptor interaction;KEGG PATHWAY;hsa04080 |
Pathway | HIF-1-alpha transcription factor network;PID Curated;200172 |
Pathway | Synthesis, Secretion, and Deacylation of Ghrelin;PID Reactome;500141 |
Disease | Rett syndrome;FunDO |
Disease | Neuroblastoma;FunDO |
Disease | Lipodystrophy;FunDO |
Disease | Obesity, severe, due to leptin deficiency;OMIM |
Disease | depression;GAD |
Disease | Obesity, morbid, with hypogonadism;OMIM |
Disease | Purpura, Thrombocytopenic, Idiopathic;FunDO |
Disease | Lung cancer;FunDO |
Disease | leptin expression;GAD |
Disease | Asthma;FunDO |
Disease | insulin;GAD |
Disease | Polyarthritis;FunDO |
Disease | obesity;GAD |
Disease | Cholelithiasis;FunDO |
Disease | AGING;GAD |
Disease | Eating disorder;FunDO |
Disease | Down syndrome;FunDO |
Disease | HIV infection;FunDO |
Disease | Sickle cell disease;FunDO |
Disease | Helicobacter infection;FunDO |
Disease | Embryoma;FunDO |
Disease | Stomach cancer;FunDO |
Disease | hypertension;GAD |
Disease | Cirrhosis;FunDO |
Disease | Prostate cancer;FunDO |
Disease | lung cancer;GAD |
Disease | Anemia;FunDO |
Disease | Huntington disease;FunDO |
Disease | body mass leptin obesity;GAD |
Disease | Leukemia;FunDO |
Disease | PHARMACOGENOMIC;GAD |
Disease | Dental plaque;FunDO |
Disease | Schizophrenia;FunDO |
Disease | heart disease risk factors hypertension leptin obesity;GAD |
Disease | Kidney disease;FunDO |
Disease | Colon cancer;FunDO |
Disease | Intermediate coronary syndrome;FunDO |
Disease | leptin;GAD |
Disease | METABOLIC;GAD |
Disease | Primary biliary cirrhosis;FunDO |
Disease | age of menarche;GAD |
Disease | diabetes, type 2;GAD |
Disease | PSYCH;GAD |
Disease | Aortic aneurysm;FunDO |
Disease | Weight Gain;GAD |
Disease | prostate cancer;GAD |
Disease | Choriocarcinoma;FunDO |
Disease | Fatty liver;FunDO |
Disease | Hyperinsulinism;FunDO |
Disease | Familial Mediterranean fever;FunDO |
Disease | Hypothyroidism;FunDO |
Disease | Pancreas disease;FunDO |
Disease | Liver cancer;FunDO |
Disease | BMI;GAD |
Disease | Narcolepsy;FunDO |
Disease | Autistic disorder;FunDO |
Disease | Female reproductive system disorder;FunDO |
Disease | Multiple sclerosis;FunDO |
Disease | Chronic obstructive airway disease;FunDO |
Disease | Breast cancer;FunDO |
Disease | Growth retardation;FunDO |
Disease | Behcet syndrome;FunDO |
Disease | fat mass;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | body mass;GAD |
Disease | Overweight;GAD |
Disease | Osteoporosis;FunDO |
Disease | Ankylosing spondylitis;FunDO |
Disease | CANCER;GAD |
Disease | schizophrenia;GAD |
Disease | Transient hypertension of pregnancy;FunDO |
Disease | Obesity;FunDO |
Disease | Anorexia nervosa;FunDO |
Disease | Infertility;FunDO |
Disease | Advanced cancer;FunDO |
Disease | Protein-energy malnutrition;FunDO |
Disease | body fat;GAD |
Disease | Atherosclerosis;FunDO |
|
External Links |
|
Links to Entrez Gene | 3952 |
Links to all GeneRIF Items | 3952 |
Links to iHOP | 3952 |
|
Sequence Information |
|
Nucleotide Sequence |
>3952 : length: 504 atgcattggggaaccctgtgcggattcttgtggctttggccctatcttttctatgtccaa gctgtgcccatccaaaaagtccaagatgacaccaaaaccctcatcaagacaattgtcacc aggatcaatgacatttcacacacgcagtcagtctcctccaaacagaaagtcaccggtttg gacttcattcctgggctccaccccatcctgaccttatccaagatggaccagacactggca gtctaccaacagatcctcaccagtatgccttccagaaacgtgatccaaatatccaacgac ctggagaacctccgggatcttcttcacgtgctggccttctctaagagctgccacttgccc tgggccagtggcctggagaccttggacagcctggggggtgtcctggaagcttcaggctac tccacagaggtggtggccctgagcaggctgcaggggtctctgcaggacatgctgtggcag ctggacctcagccctgggtgctga |
Protein Sequence |
>3952 : length: 167 MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGL DFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLP WASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |