| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 4090 |
Name | SMAD5 |
Synonym | DWFC|JV5-1|MADH5;SMAD family member 5;SMAD5;SMAD family member 5 |
Definition | MAD, mothers against decapentaplegic homolog 5|SMA- and MAD-related protein 5|SMAD, mothers against DPP homolog 5|mothers against decapentaplegic homolog 5|mothers against decapentaplegic, drosophila, homolog of, 5 |
Position | 5q31 |
Gene Type | protein-coding |
PAH Type | Description |
HPH | Downregulation of type II bone morphogenetic protein receptor in hypoxic pulmonary hypertension. |
PAH | Smad-dependent and smad-independent induction of id1 by prostacyclin analogues inhibits proliferation of pulmonary artery smooth muscle cells in vitro and in vivo. |
PH | Smad-dependent and smad-independent induction of id1 by prostacyclin analogues inhibits proliferation of pulmonary artery smooth muscle cells in vitro and in vivo. |
| More detail of all Rat literatures about SMAD5 | |
Pathways and Diseases | |
Pathway | ctcf: first multivalent nuclear factor;PID BioCarta;100194 |
Pathway | BMP receptor signaling;PID Curated;200123 |
Pathway | alk in cardiac myocytes;PID BioCarta;100244 |
Pathway | Wnt signaling pathway;PANTHER;P00057 |
Pathway | Signaling by BMP;Reactome;REACT:12034 |
Pathway | ALK1 signaling events;PID Curated;200126 |
Pathway | TGF-beta signaling pathway;PANTHER;P00052 |
Pathway | BMP Signalling Pathway;BioCyc;PWY66-11 |
Pathway | ALK2 signaling events;PID Curated;200138 |
Pathway | TGF-beta signaling pathway;KEGG PATHWAY;hsa04350 |
Disease | Schizophrenia;FunDO |
Disease | Liver cancer;FunDO |
Disease | Helicobacter infection;FunDO |
Disease | Lung cancer;FunDO |
External Links | |
Links to Entrez Gene | 4090 |
Links to all GeneRIF Items | 4090 |
Links to iHOP | 4090 |
Sequence Information | |
Nucleotide Sequence | >4090 : length: 1398 atgacgtcaatggccagcttgttttcttttactagtccagcagtaaagcgattgttgggc tggaaacaaggtgatgaggaggagaaatgggcagaaaaggcagttgatgctttggtgaag aaactaaaaaagaaaaagggtgccatggaggaactggagaaagccttgagcagtccagga cagccgagtaaatgtgtcactattcccagatctttagatggacgcctgcaggtttctcac agaaaaggcttaccccatgttatatattgtcgtgtttggcgctggccggatttgcagagt catcatgagctaaagccgttggatatttgtgaatttccttttggatctaagcaaaaagaa gtttgtatcaacccataccactataagagagtggagagtccagtcttacctccagtatta gtgcctcgtcataatgaattcaatccacaacacagccttctggttcagtttaggaacctg agccacaatgaaccacacatgccacaaaatgccacgtttccagattctttccaccagccc aacaacactccttttcccttatctccaaacagcccttatcccccttctcctgctagcagc acatatcccaactccccagcaagttctggaccaggaagtccatttcagctcccagctgat acgcctcctcctgcctatatgccacctgatgatcagatgggtcaagataattcccagcct atggatacaagcaataatatgattcctcagattatgcccagtatatccagcagggatgtt cagcctgttgcctatgaagagcctaaacattggtgttcaatagtctactatgaattaaac aatcgtgttggagaagcttttcatgcatcttctactagtgtgttagtagatggattcaca gatccttcaaataacaaaagtagattctgcttgggtttgttgtcaaatgttaatcgtaat tcgacaattgaaaacactaggcgacatattggaaaaggtgttcatctgtactatgttggt ggagaggtgtatgcggaatgcctcagtgacagcagcatatttgtacagagtaggaactgc aactttcatcatggctttcatcccaccactgtctgtaagattcccagcagctgcagcctc aaaatttttaacaatcaggagtttgctcagcttctggctcaatctgtcaaccatgggttt gaggcagtatatgagctcaccaaaatgtgtaccattcggatgagttttgtcaagggttgg ggagcagaatatcaccggcaggatgtaaccagcaccccatgttggattgagattcatctt catgggcctcttcagtggctggataaagtccttactcagatgggctcccctctgaacccc atatcttctgtttcataa |
Protein Sequence | >4090 : length: 465 MTSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPG QPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKE VCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQP NNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQP MDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT DPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNC NFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGW GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS |