| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 4092 |
Name | SMAD7 |
Synonym | CRCS3|MADH7|MADH8;SMAD family member 7;SMAD7;SMAD family member 7 |
Definition | MAD (mothers against decapentaplegic, Drosophila) homolog 7|MAD homolog 8|Mothers against decapentaplegic, drosophila, homolog of, 7|SMAD, mothers against DPP homolog 7|hSMAD7|mothers against DPP homolog 8|mothers against decapentaplegic homolog 7 |
Position | 18q21.1 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PH | Supplemental Table 1: A list of genes and functional categories that comprises a PHrelevant gene module (PH-module). |
| More detail of all Human literatures about SMAD7 | |
|
Pathways and Diseases |
|
Pathway | Endocytosis;KEGG PATHWAY;hsa04144 |
Pathway | TGF-beta receptor signaling;PID Curated;200195 |
Pathway | BMP receptor signaling;PID Curated;200123 |
Pathway | Signaling events mediated by HDAC Class I;PID Curated;200070 |
Pathway | Signaling by BMP;Reactome;REACT:12034 |
Pathway | Regulation of nuclear SMAD2/3 signaling;PID Curated;200002 |
Pathway | ALK1 signaling events;PID Curated;200126 |
Pathway | TGF-beta signaling pathway;PANTHER;P00052 |
Pathway | BMP Signalling Pathway;BioCyc;PWY66-11 |
Pathway | tgf beta signaling pathway;PID BioCarta;100017 |
Pathway | TGF-beta signaling pathway;KEGG PATHWAY;hsa04350 |
Pathway | IFN-gamma pathway;PID Curated;200110 |
Pathway | Signaling by TGF beta;Reactome;REACT:6844 |
Disease | Scleroderma;FunDO |
Disease | Colorectal cancer;NHGRI |
Disease | Diabetes mellitus;FunDO |
Disease | Chronic fatigue syndrome;FunDO |
Disease | Systemic scleroderma;FunDO |
Disease | CANCER;GAD |
Disease | Cancer;FunDO |
Disease | Colorectal cancer, susceptibility to, 3;OMIM |
Disease | Helicobacter infection;FunDO |
Disease | colorectal cancer;GAD |
|
External Links |
|
Links to Entrez Gene | 4092 |
Links to all GeneRIF Items | 4092 |
Links to iHOP | 4092 |
|
Sequence Information |
|
Nucleotide Sequence |
>4092 : length: 1278 atgttcaggaccaaacgatctgcgctcgtccggcgtctctggaggagccgtgcgcccggc ggcgaggacgaggaggagggcgcagggggaggtggaggaggaggcgagctgcggggagaa ggggcgacggacagccgagcgcatggggccggtggcggcggcccgggcagggctggatgc tgcctgggcaaggcggtgcgaggtgccaaaggtcaccaccatccccacccgccagccgcg ggcgccggcgcggccgggggcgccgaggcggatctgaaggcgctcacgcactcggtgctc aagaaactgaaggagcggcagctggagctgctgctccaggccgtggagtcccgcggcggg acgcgcaccgcgtgcctcctgctgcccggccgcctggactgcaggctgggcccgggggcg cccgccggcgcgcagcctgcgcagccgccctcgtcctactcgctccccctcctgctgtgc aaagtgttcaggtggccggatctcaggcattcctcggaagtcaagaggctgtgttgctgt gaatcttacgggaagatcaaccccgagctggtgtgctgcaacccccatcaccttagccga ctctgcgaactagagtctcccccccctccttactccagatacccgatggattttctcaaa ccaactgactgtccagatgctgtgccttcctccgctgaaacagggggaacgaattatctg gcccctggggggctttcagattcccaacttcttctggagcctggggatcggtcacactgg tgcgtggtggcatactgggaggagaagacgagagtggggaggctctactgtgtccaggag ccctctctggatatcttctatgatctacctcaggggaatggcttttgcctcggacagctc aattcggacaacaagagtcagctggtgcagaaggtgcggagcaaaatcggctgcggcatc cagctgacgcgggaggtggatggtgtgtgggtgtacaaccgcagcagttaccccatcttc atcaagtccgccacactggacaacccggactccaggacgctgttggtacacaaggtgttc cccggtttctccatcaaggctttcgactacgagaaggcgtacagcctgcagcggcccaat gaccacgagtttatgcagcagccgtggacgggctttaccgtgcagatcagctttgtgaag ggctggggccagtgctacacccgccagttcatcagcagctgcccgtgctggctagaggtc atcttcaacagccggtag |
Protein Sequence |
>4092 : length: 425 MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGC CLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGG TRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCC ESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTDCPDAVPSSAETGGTNYL APGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQL NSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVF PGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLEV IFNSR |