| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 4313 |
Name | MMP2 |
Synonym | CLG4|CLG4A|MMP-II|MONA|TBE-1;matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase);MMP2;matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) |
Definition | 72 kDa gelatinase|72 kDa type IV collagenase|MMP-2|collagenase type IV-A|gelatinase A|matrix metalloproteinase-2|matrix metalloproteinase-II|neutrophil gelatinase |
Position | 16q13-q21 |
Gene Type | protein-coding |
PAH Type | Description |
PAH | Activation of proMMP-2 and Src by HHV8 vGPCR in human pulmonary arterial endothelial cells. |
PAH | "In conclusion, BMC transfusion appears to improve survival rate, RVH, and mean RV pressure, and decreases gene expressions of ET-1, ERA, NOS 3, MMP 2, TIMP, IL-6, and TNF-alpha." |
PH | "[Changes of MMP-2,9 and TIMP-1 expressions in rats with pulmonary arterial hypertension after captopril and losartan interventions]." |
| More detail of all Human literatures about MMP2 | |
Pathways and Diseases | |
Pathway | LPA receptor mediated events;PID Curated;200011 |
Pathway | Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066 |
Pathway | Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106 |
Pathway | GnRH signaling pathway;KEGG PATHWAY;hsa04912 |
Pathway | Alzheimer disease-presenilin pathway;PANTHER;P00004 |
Pathway | inhibition of matrix metalloproteinases;PID BioCarta;100045 |
Pathway | Direct p53 effectors;PID Curated;200101 |
Pathway | Osteopontin-mediated events;PID Curated;200042 |
Pathway | Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044 |
Pathway | Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670 |
Pathway | Diabetes pathways;Reactome;REACT:15380 |
Pathway | ATF-2 transcription factor network;PID Curated;200116 |
Pathway | FOXM1 transcription factor network;PID Curated;200120 |
Pathway | Plasma membrane estrogen receptor signaling;PID Curated;200029 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Syndecan-2-mediated signaling events;PID Curated;200164 |
Pathway | Bladder cancer;KEGG PATHWAY;hsa05219 |
Pathway | amb2 Integrin signaling;PID Curated;200108 |
Disease | Vasculitis;FunDO |
Disease | gastric cardia adenocarcinoma;GAD |
Disease | oral submucous fibrosis;GAD |
Disease | Cardiovascular disease;FunDO |
Disease | Periodontitis;FunDO |
Disease | Degenerative disc disease;FunDO |
Disease | Asthma;FunDO |
Disease | Cancer;FunDO |
Disease | Rheumatoid arthritis;FunDO |
Disease | bladder cancer;GAD |
Disease | Uterine disease;FunDO |
Disease | abdominal aortic aneurysm;GAD |
Disease | Muscular dystrophy;FunDO |
Disease | Helicobacter infection;FunDO |
Disease | Obesity;FunDO |
Disease | psoriasis;GAD |
Disease | Emphysema;FunDO |
Disease | Chronic rejection of renal transplant;FunDO |
Disease | lung cancer;GAD |
Disease | atherosclerosis, coronary;GAD |
Disease | IMMUNE;GAD |
Disease | Systemic scleroderma;FunDO |
Disease | Huntington disease;FunDO |
Disease | Pulmonary fibrosis;FunDO |
Disease | prostate cancer;GAD |
Disease | Polycystic ovary syndrome;FunDO |
Disease | Choriocarcinoma;KEGG DISEASE;H00028 |
Disease | Systemic infection;FunDO |
Disease | Takayasu's arteritis;FunDO |
Disease | Ptosis;FunDO |
Disease | osteoarthritis;GAD |
Disease | rheumatoid arthritis;GAD |
Disease | esophageal cancer;GAD |
Disease | colorectal cancer;GAD |
Disease | METABOLIC;GAD |
Disease | Capillaries disease;FunDO |
Disease | Hamman-Rich syndrome;FunDO |
Disease | Diabetes mellitus;FunDO |
Disease | Bronchopulmonary dysplasia;FunDO |
Disease | Lichen planus;FunDO |
Disease | Heart Failure;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | nasopharyngeal cancer;GAD |
Disease | Glomerulonephritis;FunDO |
Disease | Behcet syndrome;FunDO |
Disease | Atherosclerosis;GAD |
Disease | Cancers of the breast and female genital organs;KEGG DISEASE |
Disease | CNS metastases;FunDO |
Disease | gastric cardia adenocarcinoma and esophageal squamous cell carcinoma;GAD |
Disease | Acne;FunDO |
Disease | Growth retardation;FunDO |
Disease | Cancers;KEGG DISEASE |
Disease | Hepatitis B;FunDO |
Disease | Sinusitis;FunDO |
Disease | Bone disease;FunDO |
Disease | breast cancer;GAD |
Disease | CANCER;GAD |
Disease | Transient hypertension of pregnancy;FunDO |
Disease | Skin cancer;FunDO |
Disease | Torg-Winchester syndrome;OMIM |
Disease | oral cancer;GAD |
Disease | stomach cancer;GAD |
Disease | Arthritis;FunDO |
External Links | |
Links to Entrez Gene | 4313 |
Links to all GeneRIF Items | 4313 |
Links to iHOP | 4313 |
Sequence Information | |
Nucleotide Sequence | >4313 : length: 1833 atgcaatacctgaacaccttctatggctgccccaaggagagctgcaacctgtttgtgctg aaggacacactaaagaagatgcagaagttctttggactgccccagacaggtgatcttgac cagaataccatcgagaccatgcggaagccacgctgcggcaacccagatgtggccaactac aacttcttccctcgcaagcccaagtgggacaagaaccagatcacatacaggatcattggc tacacacctgatctggacccagagacagtggatgatgcctttgctcgtgccttccaagtc tggagcgatgtgaccccactgcggttttctcgaatccatgatggagaggcagacatcatg atcaactttggccgctgggagcatggcgatggatacccctttgacggtaaggacggactc ctggctcatgccttcgccccaggcactggtgttgggggagactcccattttgatgacgat gagctatggaccttgggagaaggccaagtggtccgtgtgaagtatgggaacgccgatggg gagtactgcaagttccccttcttgttcaatggcaaggagtacaacagctgcactgatacc ggccgcagcgatggcttcctctggtgctccaccacctacaactttgagaaggatggcaag tacggcttctgtccccatgaagccctgttcaccatgggcggcaacgctgaaggacagccc tgcaagtttccattccgcttccagggcacatcctatgacagctgcaccactgagggccgc acggatggctaccgctggtgcggcaccactgaggactacgaccgcgacaagaagtatggc ttctgccctgagaccgccatgtccactgttggtgggaactcagaaggtgccccctgtgtc ttccccttcactttcctgggcaacaaatatgagagctgcaccagcgccggccgcagtgac ggaaagatgtggtgtgcgaccacagccaactacgatgatgaccgcaagtggggcttctgc cctgaccaagggtacagcctgttcctcgtggcagcccacgagtttggccacgccatgggg ctggagcactcccaagaccctggggccctgatggcacccatttacacctacaccaagaac ttccgtctgtcccaggatgacatcaagggcattcaggagctctatggggcctctcctgac attgaccttggcaccggccccacccccacgctgggccctgtcactcctgagatctgcaaa caggacattgtatttgatggcatcgctcagatccgtggtgagatcttcttcttcaaggac cggttcatttggcggactgtgacgccacgtgacaagcccatggggcccctgctggtggcc acattctggcctgagctcccggaaaagattgatgcggtatacgaggccccacaggaggag aaggctgtgttctttgcagggaatgaatactggatctactcagccagcaccctggagcga gggtaccccaagccactgaccagcctgggactgccccctgatgtccagcgagtggatgcc gcctttaactggagcaaaaacaagaagacatacatctttgctggagacaaattctggaga tacaatgaggtgaagaagaaaatggatcctggcttccccaagctcatcgcagatgcctgg aatgccatccccgataacctggatgccgtcgtggacctgcagggcggcggtcacagctac ttcttcaagggtgcctattacctgaagctggagaaccaaagtctgaagagcgtgaagttt ggaagcatcaaatccgactggctaggctgctga |
Protein Sequence | >4313 : length: 610 MQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANY NFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIM INFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADG EYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQP CKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCV FPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMG LEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICK QDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEE KAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWR YNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKF GSIKSDWLGC |