| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 4314 |
Name | MMP3 |
Synonym | CHDS6|MMP-3|SL-1|STMY|STMY1|STR1;matrix metallopeptidase 3 (stromelysin 1, progelatinase);MMP3;matrix metallopeptidase 3 (stromelysin 1, progelatinase) |
Definition | matrix metalloproteinase 3 (stromelysin 1, progelatinase)|matrix metalloproteinase-3|proteoglycanase|stromelysin-1|transin-1 |
Position | 11q22.3 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | "Deciphering the ""matrix"" in pulmonary vascular remodelling." |
| More detail of all Human literatures about MMP3 | |
|
Pathways and Diseases |
|
Pathway | p75(NTR)-mediated signaling;PID Curated;200103 |
Pathway | Plasminogen activating cascade;PANTHER;P00050 |
Disease | DEVELOPMENTAL;GAD |
Disease | Acute Coronary Syndrome;GAD |
Disease | Alzheimer's disease;GAD |
Disease | Alzheimer's disease dementia, vascular;GAD |
Disease | atherosclerosis, coronary unstable coronary syndrome;GAD |
Disease | Lung cancer;FunDO |
Disease | Periodontitis;FunDO |
Disease | cleft lip with cleft palate cleft lip without cleft palate;GAD |
Disease | Melanoma;FunDO |
Disease | carotid artery atherosclerosis;GAD |
Disease | Coronary heart disease, susceptibility to, 6;OMIM |
Disease | Polyarthritis;FunDO |
Disease | Oral cancer;FunDO |
Disease | bladder cancer;GAD |
Disease | arthritis;GAD |
Disease | Breast cancer;FunDO |
Disease | Mucocutaneous lymph node syndrome;FunDO |
Disease | Endometriosis;FunDO |
Disease | Takayasu's arteritis;FunDO |
Disease | Metabolism disease;FunDO |
Disease | Ulcerative colitis;FunDO |
Disease | Obesity;FunDO |
Disease | matrix metalloproteinase-3 concentration myocardial infarct;GAD |
Disease | AGING;GAD |
Disease | oral cancer oral submucous fibrosis;GAD |
Disease | lung cancer;GAD |
Disease | atherosclerosis, coronary;GAD |
Disease | IMMUNE;GAD |
Disease | Parkinson's disease;GAD |
Disease | Rheumatoid arthritis;FunDO |
Disease | Esophagus cancer;FunDO |
Disease | colorectal cancer.;GAD |
Disease | head and neck cancer;GAD |
Disease | degeneration of intervertebral discs;GAD |
Disease | periodontitis;GAD |
Disease | rheumatoid arthritis;GAD |
Disease | Varicosity;FunDO |
Disease | Colon cancer;FunDO |
Disease | Alzheimer's disease;FunDO |
Disease | Cholangiocarcinoma;FunDO |
Disease | aortic stenosis;GAD |
Disease | cholangitis, sclerosing;GAD |
Disease | Ewings sarcoma;FunDO |
Disease | primary sclerosing cholangitis;GAD |
Disease | Adenoma;FunDO |
Disease | Lichen planus;FunDO |
Disease | Coronary Artery Disease;GAD |
Disease | Celiac Disease;GAD |
Disease | restenosis;GAD |
Disease | Stroke;GAD |
Disease | Multiple sclerosis;FunDO |
Disease | CANCER;GAD |
Disease | blood pressure, arterial;GAD |
Disease | Liver cancer;FunDO |
Disease | Pneumoconiosis;FunDO |
Disease | Brain tumor;FunDO |
Disease | Thromboangiitis obliterans;FunDO |
Disease | kidney cancer;GAD |
Disease | Lymphatic metastasis;FunDO |
Disease | NEUROLOGICAL;GAD |
Disease | Necrotizing enterocolitis;FunDO |
Disease | Renal Cell cancer;FunDO |
Disease | Cirrhosis;FunDO |
Disease | Squamous cell cancer;FunDO |
Disease | Gouts;FunDO |
Disease | CARDIOVASCULAR;GAD |
Disease | carotid artery stenosis;GAD |
Disease | Enteritis;FunDO |
Disease | Chondrosarcoma;FunDO |
Disease | Ovarian cancer;FunDO |
Disease | Lymphoma;FunDO |
Disease | Amyloidosis;FunDO |
Disease | left ventricular dysfunction;GAD |
Disease | Congenital abnormality;FunDO |
Disease | Myocardial Infarction;GAD |
Disease | Atherosclerosis;GAD |
Disease | colorectal cancer;GAD |
Disease | myocardial infarct;GAD |
Disease | Crohn's disease ulcerative colitis;GAD |
Disease | Atherosclerosis;FunDO |
|
External Links |
|
Links to Entrez Gene | 4314 |
Links to all GeneRIF Items | 4314 |
Links to iHOP | 4314 |
|
Sequence Information |
|
Nucleotide Sequence |
>4314 : length: 1434 atgaagagtcttccaatcctactgttgctgtgcgtggcagtttgctcagcctatccattg gatggagctgcaaggggtgaggacaccagcatgaaccttgttcagaaatatctagaaaac tactacgacctcaaaaaagatgtgaaacagtttgttaggagaaaggacagtggtcctgtt gttaaaaaaatccgagaaatgcagaagttccttggattggaggtgacggggaagctggac tccgacactctggaggtgatgcgcaagcccaggtgtggagttcctgatgttggtcacttc agaacctttcctggcatcccgaagtggaggaaaacccaccttacatacaggattgtgaat tatacaccagatttgccaaaagatgctgttgattctgctgttgagaaagctctgaaagtc tgggaagaggtgactccactcacattctccaggctgtatgaaggagaggctgatataatg atctcttttgcagttagagaacatggagacttttacccttttgatggacctggaaatgtt ttggcccatgcctatgcccctgggccagggattaatggagatgcccactttgatgatgat gaacaatggacaaaggatacaacagggaccaatttatttctcgttgctgctcatgaaatt ggccactccctgggtctctttcactcagccaacactgaagctttgatgtacccactctat cactcactcacagacctgactcggttccgcctgtctcaagatgatataaatggcattcag tccctctatggacctccccctgactcccctgagacccccctggtacccacggaacctgtc cctccagaacctgggacgccagccaactgtgatcctgctttgtcctttgatgctgtcagc actctgaggggagaaatcctgatctttaaagacaggcacttttggcgcaaatccctcagg aagcttgaacctgaattgcatttgatctcttcattttggccatctcttccttcaggcgtg gatgccgcatatgaagttactagcaaggacctcgttttcatttttaaaggaaatcaattc tgggctatcagaggaaatgaggtacgagctggatacccaagaggcatccacaccctaggt ttccctccaaccgtgaggaaaatcgatgcagccatttctgataaggaaaagaacaaaaca tatttctttgtagaggacaaatactggagatttgatgagaagagaaattccatggagcca ggctttcccaagcaaatagctgaagactttccagggattgactcaaagattgatgctgtt tttgaagaatttgggttcttttatttctttactggatcttcacagttggagtttgaccca aatgcaaagaaagtgacacacactttgaagagtaacagctggcttaattgttga |
Protein Sequence |
>4314 : length: 477 MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPV VKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVN YTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNV LAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLY HSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVS TLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQF WAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEP GFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC |