| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 4318 |
Name | MMP9 |
Synonym | CLG4B|GELB|MANDP2|MMP-9;matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase);MMP9;matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase) |
Definition | 92 kDa gelatinase|92 kDa type IV collagenase|macrophage gelatinase|matrix metalloproteinase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)|matrix metalloproteinase-9|type V collagenase |
Position | 20q11.2-q13.1 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | Identification of candidate genes in scleroderma-related pulmonary arterial hypertension. |
PAH | "[Changes of MMP-2,9 and TIMP-1 expressions in rats with pulmonary arterial hypertension after captopril and losartan interventions]." |
PAH | Toll-like receptor 4-deficient mice are resistant to chronic hypoxia-induced pulmonary hypertension. |
| More detail of all Rat literatures about MMP9 | |
|
Pathways and Diseases |
|
Pathway | LPA receptor mediated events;PID Curated;200011 |
Pathway | Syndecan-4-mediated signaling events;PID Curated;200115 |
Pathway | Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106 |
Pathway | Plasma membrane estrogen receptor signaling;PID Curated;200029 |
Pathway | Validated targets of C-MYC transcriptional activation;PID Curated;200045 |
Pathway | Alzheimer disease-presenilin pathway;PANTHER;P00004 |
Pathway | inhibition of matrix metalloproteinases;PID BioCarta;100045 |
Pathway | Osteopontin-mediated events;PID Curated;200042 |
Pathway | Syndecan-1-mediated signaling events;PID Curated;200134 |
Pathway | CXCR4-mediated signaling events;PID Curated;200083 |
Pathway | Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044 |
Pathway | Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670 |
Pathway | AP-1 transcription factor network;PID Curated;200118 |
Pathway | amb2 Integrin signaling;PID Curated;200108 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Bladder cancer;KEGG PATHWAY;hsa05219 |
Pathway | FGF signaling pathway;PID Curated;200189 |
Disease | arterial stiffness;GAD |
Disease | Cancer;FunDO |
Disease | Oral cancer;FunDO |
Disease | Respiratory tract disease;FunDO |
Disease | Henoch-Schoenlein purpura;FunDO |
Disease | Glaucoma;FunDO |
Disease | IMMUNE;GAD |
Disease | aortic dissection;GAD |
Disease | INFECTION;GAD |
Disease | Bronchopulmonary dysplasia;FunDO |
Disease | Subacute sclerosing panencephalitis;FunDO |
Disease | Tropical spastic paraparesis;FunDO |
Disease | Penile cancer;KEGG DISEASE;H00025 |
Disease | Hypertension;FunDO |
Disease | ocular Chlamydia trachomatis infection;GAD |
Disease | Lupus vulgaris;FunDO |
Disease | Transient hypertension of pregnancy;FunDO |
Disease | Macular Degeneration;GAD |
Disease | myocardial infarct;GAD |
Disease | Atherosclerosis;FunDO |
Disease | Ischemia;FunDO |
Disease | nephropathy;GAD |
Disease | Helicobacter infection;FunDO |
Disease | oral cancer;GAD |
Disease | Emphysema;FunDO |
Disease | Amnionitis;FunDO |
Disease | atherosclerosis, coronary;GAD |
Disease | Metaphyseal anadysplasia 2;OMIM |
Disease | prostate cancer;GAD |
Disease | Systemic infection;FunDO |
Disease | Metabolism disease;FunDO |
Disease | emphysema;GAD |
Disease | METABOLIC;GAD |
Disease | Gastritis;FunDO |
Disease | HTLV-I infection;FunDO |
Disease | Kidney Failure, Chronic;GAD |
Disease | Behcet syndrome;FunDO |
Disease | IGA glomerulonephritis;FunDO |
Disease | left ventricular dysfunction;GAD |
Disease | Cancers of the urinary system and male genital organs;KEGG DISEASE |
Disease | chronic obstructive pulmonary disease/COPD;GAD |
Disease | endometrial cancer;GAD |
Disease | atherosclerosis, carotid;GAD |
Disease | Arthritis;FunDO |
Disease | Arteriopathy;FunDO |
Disease | Alzheimer's disease dementia, vascular;GAD |
Disease | Mucocutaneous lymph node syndrome;FunDO |
Disease | Pleural effusion, Malignant;FunDO |
Disease | Dental plaque;FunDO |
Disease | colorectal cancer;GAD |
Disease | Pre-Eclampsia;FunDO |
Disease | diabetes, type 2;GAD |
Disease | brain hemorrhage;GAD |
Disease | Ovarian disease;FunDO |
Disease | Bronchiolitis obliterans;FunDO |
Disease | Keratoconjunctivitis Sicca;FunDO |
Disease | Glomerulonephritis;FunDO |
Disease | Chronic obstructive airway disease;FunDO |
Disease | Cancers;KEGG DISEASE |
Disease | Hepatitis B;FunDO |
Disease | breast cancer;GAD |
Disease | Obesity;FunDO |
Disease | Atherosclerosis;GAD |
Disease | stomach cancer;GAD |
Disease | preterm delivery;GAD |
Disease | Periodontitis;FunDO |
Disease | bladder cancer;GAD |
Disease | abdominal aortic aneurysm;GAD |
Disease | Esotropia;FunDO |
Disease | Amyotrophic lateral sclerosis;FunDO |
Disease | Cystic fibrosis;FunDO |
Disease | VISION;GAD |
Disease | Systemic scleroderma;FunDO |
Disease | myelopathy/tropical spastic paraparesis;GAD |
Disease | Asthma;GAD |
Disease | Takayasu's arteritis;FunDO |
Disease | periodontitis;GAD |
Disease | Stroke;FunDO |
Disease | Varicosity;FunDO |
Disease | Autoimmune disease;FunDO |
Disease | bone density;GAD |
Disease | throracic aortic aneurysm throracic aortic dissection;GAD |
Disease | Lichen planus;FunDO |
Disease | CARDIOVASCULAR;GAD |
Disease | CANCER;GAD |
Disease | Endometriosis;FunDO |
Disease | NEUROLOGICAL;GAD |
Disease | glaucoma, primary open-angle;GAD |
Disease | Growth retardation;FunDO |
Disease | Heart failure;FunDO |
Disease | Sinusitis;FunDO |
Disease | Skin disease;FunDO |
Disease | Skin cancer;FunDO |
Disease | lung cancer;GAD |
Disease | RENAL;GAD |
|
External Links |
|
Links to Entrez Gene | 4318 |
Links to all GeneRIF Items | 4318 |
Links to iHOP | 4318 |
|
Sequence Information |
|
Nucleotide Sequence |
>4318 : length: 2124 atgagcctctggcagcccctggtcctggtgctcctggtgctgggctgctgctttgctgcc cccagacagcgccagtccacccttgtgctcttccctggagacctgagaaccaatctcacc gacaggcagctggcagaggaatacctgtaccgctatggttacactcgggtggcagagatg cgtggagagtcgaaatctctggggcctgcgctgctgcttctccagaagcaactgtccctg cccgagaccggtgagctggatagcgccacgctgaaggccatgcgaaccccacggtgcggg gtcccagacctgggcagattccaaacctttgagggcgacctcaagtggcaccaccacaac atcacctattggatccaaaactactcggaagacttgccgcgggcggtgattgacgacgcc tttgcccgcgccttcgcactgtggagcgcggtgacgccgctcaccttcactcgcgtgtac agccgggacgcagacatcgtcatccagtttggtgtcgcggagcacggagacgggtatccc ttcgacgggaaggacgggctcctggcacacgcctttcctcctggccccggcattcaggga gacgcccatttcgacgatgacgagttgtggtccctgggcaagggcgtcgtggttccaact cggtttggaaacgcagatggcgcggcctgccacttccccttcatcttcgagggccgctcc tactctgcctgcaccaccgacggtcgctccgacggcttgccctggtgcagtaccacggcc aactacgacaccgacgaccggtttggcttctgccccagcgagagactctacacccaggac ggcaatgctgatgggaaaccctgccagtttccattcatcttccaaggccaatcctactcc gcctgcaccacggacggtcgctccgacggctaccgctggtgcgccaccaccgccaactac gaccgggacaagctcttcggcttctgcccgacccgagctgactcgacggtgatggggggc aactcggcgggggagctgtgcgtcttccccttcactttcctgggtaaggagtactcgacc tgtaccagcgagggccgcggagatgggcgcctctggtgcgctaccacctcgaactttgac agcgacaagaagtggggcttctgcccggaccaaggatacagtttgttcctcgtggcggcg catgagttcggccacgcgctgggcttagatcattcctcagtgccggaggcgctcatgtac cctatgtaccgcttcactgaggggccccccttgcataaggacgacgtgaatggcatccgg cacctctatggtcctcgccctgaacctgagccacggcctccaaccaccaccacaccgcag cccacggctcccccgacggtctgccccaccggaccccccactgtccacccctcagagcgc cccacagctggccccacaggtcccccctcagctggccccacaggtccccccactgctggc ccttctacggccactactgtgcctttgagtccggtggacgatgcctgcaacgtgaacatc ttcgacgccatcgcggagattgggaaccagctgtatttgttcaaggatgggaagtactgg cgattctctgagggcagggggagccggccgcagggccccttccttatcgccgacaagtgg cccgcgctgccccgcaagctggactcggtctttgaggagcggctctccaagaagcttttc ttcttctctgggcgccaggtgtgggtgtacacaggcgcgtcggtgctgggcccgaggcgt ctggacaagctgggcctgggagccgacgtggcccaggtgaccggggccctccggagtggc agggggaagatgctgctgttcagcgggcggcgcctctggaggttcgacgtgaaggcgcag atggtggatccccggagcgccagcgaggtggaccggatgttccccggggtgcctttggac acgcacgacgtcttccagtaccgagagaaagcctatttctgccaggaccgcttctactgg cgcgtgagttcccggagtgagttgaaccaggtggaccaagtgggctacgtgacctatgac atcctgcagtgccctgaggactag |
Protein Sequence |
>4318 : length: 707 MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEM RGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHN ITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP FDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRS YSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS ACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYST CTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY PMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSER PTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYW RFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRR LDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLD THDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED |