| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 4846 |
Name | NOS3 |
Synonym | ECNOS|eNOS;nitric oxide synthase 3 (endothelial cell);NOS3;nitric oxide synthase 3 (endothelial cell) |
Definition | EC-NOS|NOS type III|NOSIII|cNOS|constitutive NOS|endothelial NOS|nitric oxide synthase, endothelial |
Position | 7q36 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | "In conclusion, BMC transfusion appears to improve survival rate, RVH, and mean RV pressure, and decreases gene expressions of ET-1, ERA, NOS 3, MMP 2, TIMP, IL-6, and TNF-alpha." |
PAH | "In conclusion, BMC transfusion appears to improve survival rate, RVH, and mean RV pressure, and decreases gene expressions of ET-1, ERA, NOS 3, MMP 2, TIMP, IL-6, and TNF-alpha." |
PAH | "RESULTS: With MDR method, the single-locus model of 5HTT (L/S) polymorphism and the combination of 5HTT(L/S), EDN1(K198N), and NOS3(G894T) polymorphisms in the three-locus model were attributed to be the best models for predicting susceptibility to IPAH, with a P value of 0.05". |
PH | "The NOS3-VNTR polymorphism was associated with right ventricular systolic pressure in patients with COPD, supporting its involvement in the pathogenesis of pulmonary hypertension in COPD." |
PH | This study assessed eNOS-/- mice exposed to air or cigarette smoke for the presence of pulmonary hypertension and examined vascular remodeling and expression of nitrotyrosine. |
| More detail of all Rat literatures about NOS3 | |
|
Pathways and Diseases |
|
Pathway | VEGFR1 specific signals;PID Curated;200151 |
Pathway | ion channels and their functional role in vascular endothelium;PID BioCarta;100055 |
Pathway | VEGF signaling pathway;KEGG PATHWAY;hsa04370 |
Pathway | Endothelin signaling pathway;PANTHER;P00019 |
Pathway | corticosteroids and cardioprotection;PID BioCarta;100156 |
Pathway | eNOS activation;PID Reactome;500849 |
Pathway | PI3 kinase pathway;PANTHER;P00048 |
Pathway | Metabolism of nitric oxide;Reactome;REACT:12508 |
Pathway | citrulline-nitric oxide cycle;BioCyc;PWY-4983 |
Pathway | Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161 |
Pathway | VEGF signaling pathway;PANTHER;P00056 |
Pathway | Plasma membrane estrogen receptor signaling;PID Curated;200029 |
Pathway | Thromboxane A2 receptor signaling;PID Curated;200069 |
Pathway | hypoxia-inducible factor in the cardivascular system;PID BioCarta;100145 |
Pathway | Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044 |
Pathway | Calcium signaling pathway;KEGG PATHWAY;hsa04020 |
Pathway | Angiogenesis;PANTHER;P00005 |
Pathway | actions of nitric oxide in the heart;PID BioCarta;100094 |
Pathway | Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066 |
Pathway | superpathway of citrulline metabolism;BioCyc;PWY-5004 |
Pathway | Hemostasis;Reactome;REACT:604 |
Pathway | Arginine and proline metabolism;KEGG PATHWAY;hsa00330 |
Pathway | Metabolic pathways;KEGG PATHWAY;hsa01100 |
Pathway | vegf hypoxia and angiogenesis;PID BioCarta;100006 |
Pathway | Interleukin signaling pathway;PANTHER;P00036 |
Disease | cognitive impairment;GAD |
Disease | thromboembolism, venous;GAD |
Disease | Bacteremia;GAD |
Disease | lead toxicity;GAD |
Disease | Alzheimer disease, late-onset, susceptibility to;OMIM |
Disease | arterial stiffness;GAD |
Disease | Escherichia coli Infections;GAD |
Disease | cardiac death;GAD |
Disease | Subarachnoid Hemorrhage;GAD |
Disease | DEVELOPMENTAL;GAD |
Disease | congestive heart failure;GAD |
Disease | endothelium-dependent arterial dilation;GAD |
Disease | IMMUNE;GAD |
Disease | endometriosis;GAD |
Disease | atherosclerosis, carotid intima media thickness;GAD |
Disease | vasodilation;GAD |
Disease | kidney dysfunction;GAD |
Disease | blood pressure;GAD |
Disease | angina, vasospastic;GAD |
Disease | PSYCH;GAD |
Disease | heart disease, ischemic;GAD |
Disease | cardiopulmonary disease;GAD |
Disease | Placental abruption;OMIM |
Disease | Angina, Unstable;GAD |
Disease | vasospastic angina associated;GAD |
Disease | Pulmonary Edema;GAD |
Disease | coronary atherosclerotic heart disease in Chinese;GAD |
Disease | nephropathy, diabetic;GAD |
Disease | enhanced vascular responsiveness to phenylephrine;GAD |
Disease | Fabry disease;GAD |
Disease | coronary vasomotor function;GAD |
Disease | carotid artery stenosis;GAD |
Disease | blood flow;GAD |
Disease | Hypotension;GAD |
Disease | smoking;GAD |
Disease | renal disease;GAD |
Disease | metabolic syndrome;GAD |
Disease | Hypertriglyceridemia;GAD |
Disease | myocardial infarct;GAD |
Disease | polycystic kidney disease;GAD |
Disease | pregnancy loss, recurrent;GAD |
Disease | Insulin Resistance;GAD |
Disease | cardiovascular;GAD |
Disease | sickle cell anemia;GAD |
Disease | C-reactive protein;GAD |
Disease | giant cell arteritis.;GAD |
Disease | nephropathy;GAD |
Disease | hypertension;GAD |
Disease | stroke, ischemic;GAD |
Disease | vulvar cancer;GAD |
Disease | neural tube defects;GAD |
Disease | atherosclerosis, coronary;GAD |
Disease | sclerosis, systemic;GAD |
Disease | kidney transplant;GAD |
Disease | renal disease, end stage;GAD |
Disease | high-altitude pulmonary edema.;GAD |
Disease | cardiovascular disease;GAD |
Disease | Ischemic stroke, susceptibility to;OMIM |
Disease | prostate cancer;GAD |
Disease | Vasculitis;GAD |
Disease | cholesterol cholesterol, LDL fibrinogen lipoprotein myocardial infarct nitrate triglycerides;GAD |
Disease | placental abruption;GAD |
Disease | METABOLIC;GAD |
Disease | brain aneurysm;GAD |
Disease | Hypertension, susceptibility to;OMIM |
Disease | diabetes, type 1;GAD |
Disease | preeclampsia;GAD |
Disease | systemic sclerosis;GAD |
Disease | Kidney Failure, Chronic;GAD |
Disease | homocysteine;GAD |
Disease | NORMALVARIATION;GAD |
Disease | hypertension, pregnancy induced;GAD |
Disease | Atherosclerosis;GAD |
Disease | Vasospasm, Intracranial;GAD |
Disease | coronary spasm.;GAD |
Disease | intracranial aneurysms;GAD |
Disease | Behcet's Disease;GAD |
Disease | tardive dyskinesia;GAD |
Disease | suicide;GAD |
Disease | elite athletes;GAD |
Disease | chronic obstructive pulmonary disease/COPD;GAD |
Disease | Myocardial Infarction;GAD |
Disease | end stage renal disease;GAD |
Disease | Hypertension, pregnancy-induced;OMIM |
Disease | bipolar disorder;GAD |
Disease | exhaled nitric oxide levels;GAD |
Disease | blood pressure, arterial hypertension;GAD |
Disease | hypertension, cirrhotic portal;GAD |
Disease | heart period signal;GAD |
Disease | Atrial Fibrillation;GAD |
Disease | peripheral vascular disease;GAD |
Disease | white blood cell count;GAD |
Disease | HEMATOLOGICAL;GAD |
Disease | erectile dysfunction;GAD |
Disease | Pseudomonas aeruginosa infection;GAD |
Disease | endothelial function von Willebrand factor;GAD |
Disease | AGING;GAD |
Disease | Acute Coronary Syndrome;GAD |
Disease | neuropathy, non-arteritic ischaemic optic;GAD |
Disease | Altitude Sickness;GAD |
Disease | periodontal disease;GAD |
Disease | sickle cell disease;GAD |
Disease | fibrinogen;GAD |
Disease | Behcet Syndrome;GAD |
Disease | lupus erythematosus;GAD |
Disease | high-altitude pulmonary edema;GAD |
Disease | retinopathy, diabetic;GAD |
Disease | colorectal cancer;GAD |
Disease | Diabetic Retinopathy;GAD |
Disease | diabetes, type 2;GAD |
Disease | Coronary Artery Disease;GAD |
Disease | Chronic renal failure;GAD |
Disease | macular edema;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | insulin;GAD |
Disease | cerebral circulation;GAD |
Disease | coronary in-stent restenosis.;GAD |
Disease | restenosis;GAD |
Disease | INFECTION;GAD |
Disease | REPRODUCTION;GAD |
Disease | blood pressure, arterial;GAD |
Disease | vasodilation during pregnancy;GAD |
Disease | angina;GAD |
Disease | pulmonary function;GAD |
Disease | homocystinuria;GAD |
Disease | breast cancer;GAD |
Disease | coronary heart disease;GAD |
Disease | ovarian cancer;GAD |
Disease | migraine with aura;GAD |
Disease | diabetic nephropathy;GAD |
Disease | pulmonary hypertension;GAD |
Disease | allergy asthma;GAD |
Disease | preterm delivery;GAD |
Disease | Alzheimer's disease;GAD |
Disease | platelet aggregation;GAD |
Disease | nitric oxide activity;GAD |
Disease | carotid atherosclerosis;GAD |
Disease | Essential Hypertension;GAD |
Disease | Skin Diseases;GAD |
Disease | end-stage renal disease;GAD |
Disease | nephropathy in other diseases;GAD |
Disease | Cerebral Circulation in Smokers;GAD |
Disease | Gram-Positive Bacterial Infections;GAD |
Disease | endothelial function;GAD |
Disease | Osteomyelitis;GAD |
Disease | Asthma;GAD |
Disease | vessel stenosis;GAD |
Disease | peritoneal transport;GAD |
Disease | heart rate;GAD |
Disease | hyperhomocystinemia;GAD |
Disease | endurance performance;GAD |
Disease | bone density fracture risk;GAD |
Disease | CANCER;GAD |
Disease | coronary vasculopathy;GAD |
Disease | Stroke;GAD |
Disease | carotid intima-media thickness;GAD |
Disease | giant cell arteritis;GAD |
Disease | NEUROLOGICAL;GAD |
Disease | cholesterol, LDL;GAD |
Disease | arterial disease;GAD |
Disease | Coronary artery spasm 1, susceptibility to;OMIM |
Disease | hypertension,response to exercise;GAD |
Disease | nitric oxide;GAD |
Disease | lung cancer;GAD |
Disease | RENAL;GAD |
|
External Links |
|
Links to Entrez Gene | 4846 |
Links to all GeneRIF Items | 4846 |
Links to iHOP | 4846 |
|
Sequence Information |
|
Nucleotide Sequence |
>4846 : length: 3612 atgggcaacttgaagagcgtggcccaggagcctgggccaccctgcggcctggggctgggg ctgggccttgggctgtgcggcaagcagggcccagccaccccggcccctgagcccagccgg gccccagcatccctactcccaccagcgccagaacacagccccccgagctccccgctaacc cagcccccagaggggcccaagttccctcgtgtgaagaactgggaggtggggagcatcacc tatgacaccctcagcgcccaggcgcagcaggatgggccctgcaccccaagacgctgcctg ggctccctggtatttccacggaaactacagggccggccctcccccggccccccggcccct gagcagctgctgagtcaggcccgggacttcatcaaccagtactacagctccattaagagg agcggctcccaggcccacgaacagcggcttcaagaggtggaagccgaggtggcagccaca ggcacctaccagcttagggagagcgagctggtgttcggggctaagcaggcctggcgcaac gctccccgctgcgtgggccggatccagtgggggaagctgcaggtgttcgatgcccgggac tgcaggtctgcacaggaaatgttcacctacatctgcaaccacatcaagtatgccaccaac cggggcaaccttcgctcggccatcacagtgttcccgcagcgctgccctggccgaggagac ttccgaatctggaacagccagctggtgcgctacgcgggctaccggcagcaggatggctct gtgcggggggacccagccaacgtggagatcaccgagctctgcattcagcacggctggacc ccaggaaacggtcgcttcgacgtgctgcccctgctgctgcaggccccagatgatccccca gaactcttccttctgccccccgagctggtccttgaggtgcccctggagcaccccacgctg gagtggtttgcagccctgggcctgcgctggtacgccctcccggcagtgtccaacatgctg ctggaaattgggggcctggagttccccgcagcccccttcagtggctggtacatgagcact gagatcggcacgaggaacctgtgtgaccctcaccgctacaacatcctggaggatgtggct gtctgcatggacctggatacccggaccacctcgtccctgtggaaagacaaggcagcagtg gaaatcaacgtggccgtgctgcacagttaccagctagccaaagtcaccatcgtggaccac cacgccgccacggcctctttcatgaagcacctggagaatgagcagaaggccagggggggc tgccctgcagactgggcctggatcgtgccccccatctcgggcagcctcactcctgttttc catcaggagatggtcaactatttcctgtccccggccttccgctaccagccagacccctgg aaggggagtgccgccaagggcaccggcatcaccaggaagaagacctttaaagaagtggcc aacgccgtgaagatctccgcctcgctcatgggcacggtgatggcgaagcgagtgaaggcg acaatcctgtatggctccgagaccggccgggcccagagctacgcacagcagctggggaga ctcttccggaaggcttttgatccccgggtcctgtgtatggatgagtatgacgtggtgtcc ctcgaacacgagacgctggtgctggtggtaaccagcacatttgggaatggggatcccccg gagaatggagagagctttgcagctgccctgatggagatgtccggcccctacaacagctcc cctcggccggaacagcacaagagttataagatccgcttcaacagcatctcctgctcagac ccactggtgtcctcttggcggcggaagaggaaggagtccagtaacacagacagtgcaggg gccctgggcaccctcaggttctgtgtgttcgggctcggctcccgggcatacccccacttc tgcgcctttgctcgtgccgtggacacacggctggaggaactgggcggggagcggctgctg cagctgggccagggcgacgagctgtgcggccaggaggaggccttccgaggctgggcccag gctgccttccaggccgcctgtgagaccttctgtgtgggagaggatgccaaggccgccgcc cgagacatcttcagccccaaacggagctggaagcgccagaggtaccggctgagcgcccag gccgagggcctgcagttgctgccaggtctgatccacgtgcacaggcggaagatgttccag gctacaatccgctcagtggaaaacctgcaaagcagcaagtccacgagggccaccatcctg gtgcgcctggacaccggaggccaggaggggctgcagtaccagccgggggaccacataggt gtctgcccgcccaaccggcccggccttgtggaggcgctgctgagccgcgtggaggacccg ccggcgcccactgagcccgtggcagtagagcagctggagaagggcagccctggtggccct ccccccggctgggtgcgggacccccggctgcccccgtgcacgctgcgccaggctctcacc ttcttcctggacatcacctccccacccagccctcagctcttgcggctgctcagcaccttg gcagaagagcccagggaacagcaggagctggaggccctcagccaggatccccgacgctac gaggagtggaagtggttccgctgccccacgctgctggaggtgctggagcagttcccgtcg gtggcgctgcctgccccactgctcctcacccagctgcctctgctccagccccggtactac tcagtcagctcggcacccagcacccacccaggagagatccacctcactgtagctgtgctg gcatacaggactcaggatgggctgggccccctgcactatggagtctgctccacgtggcta agccagctcaagcccggagaccctgtgccctgcttcatccggggggctccctccttccgg ctgccacccgatcccagcttgccctgcatcctggtgggtccaggcactggcattgccccc ttccggggattctggcaggagcggctgcatgacattgagagcaaagggctgcagcccact cccatgactttggtgttcggctgccgatgctcccaacttgaccatctctaccgcgacgag gtgcagaacgcccagcagcgcggggtgtttggccgagtcctcaccgccttctcccgggaa cctgacaaccccaagacctacgtgcaggacatcctgaggacggagctggctgcggaggtg caccgcgtgctgtgcctcgagcggggccacatgtttgtctgcggcgatgttaccatggca accaacgtcctgcagaccgtgcagcgcatcctggcgacggagggcgacatggagctggac gaggccggcgacgtcatcggcgtgctgcgggatcagcaacgctaccacgaagacattttc gggctcacgctgcgcacccaggaggtgacaagccgcatacgcacccagagcttttccttg caggagcgtcagttgcggggcgcagtgccctgggcgttcgaccctcccggctcagacacc aacagcccctga |
Protein Sequence |
>4846 : length: 1203 MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLT QPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAP EQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRN APRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGD FRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDDPP ELFLLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMST EIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDH HAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPW KGSAAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGR LFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSS PRPEQHKSYKIRFNSISCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHF CAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAA RDIFSPKRSWKRQRYRLSAQAEGLQLLPGLIHVHRRKMFQATIRSVENLQSSKSTRATIL VRLDTGGQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPAPTEPVAVEQLEKGSPGGP PPGWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPREQQELEALSQDPRRY EEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSTHPGEIHLTVAVL AYRTQDGLGPLHYGVCSTWLSQLKPGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAP FRGFWQERLHDIESKGLQPTPMTLVFGCRCSQLDHLYRDEVQNAQQRGVFGRVLTAFSRE PDNPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATNVLQTVQRILATEGDMELD EAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWAFDPPGSDT NSP |