| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 5594 |
Name | MAPK1 |
Synonym | ERK|ERK2|ERT1|MAPK2|P42MAPK|PRKM1|PRKM2|p38|p40|p41|p41mapk;mitogen-activated protein kinase 1;MAPK1;mitogen-activated protein kinase 1 |
Definition | ERK-2|MAP kinase 1|MAP kinase 2|MAP kinase isoform p42|MAPK 2|extracellular signal-regulated kinase 2|mitogen-activated protein kinase 2|p42-MAPK|protein tyrosine kinase ERK2 |
Position | 22q11.21 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | "The results showed that MCT induced pulmonary arterial remodeling, raised the serotonylation and membrane translocation of RhoA in the lungs, and increased serotonin transporter (5-HTT), RhoA, and ROCK2 expression, and extracellular signal-regulated kinase (ERK) and Akt phosphorylation in the pulmonary arteries and the lungs." |
PAH | "The results showed that MCT induced pulmonary arterial remodeling, raised the serotonylation and membrane translocation of RhoA in the lungs, and increased serotonin transporter (5-HTT), RhoA, and ROCK2 expression, and extracellular signal-regulated kinase (ERK) and Akt phosphorylation in the pulmonary arteries and the lungs." |
| More detail of all Rat literatures about MAPK1 | |
|
Pathways and Diseases |
|
Pathway | il-2 receptor beta chain in t cell activation;PID BioCarta;100129 |
Pathway | Fc gamma R-mediated phagocytosis;KEGG PATHWAY;hsa04666 |
Pathway | role of erbb2 in signal transduction and oncology;PID BioCarta;100147 |
Pathway | Class IB PI3K non-lipid kinase events;PID Curated;200081 |
Pathway | ccr3 signaling in eosinophils;PID BioCarta;100215 |
Pathway | mechanism of gene regulation by peroxisome proliferators via ppara;PID BioCarta;100066 |
Pathway | MAPK signaling pathway;KEGG PATHWAY;hsa04010 |
Pathway | Endometrial cancer;KEGG PATHWAY;hsa05213 |
Pathway | TGF-beta signaling pathway;PANTHER;P00052 |
Pathway | VEGFR1 specific signals;PID Curated;200151 |
Pathway | sprouty regulation of tyrosine kinase signals;PID BioCarta;100029 |
Pathway | FGF signaling pathway;PANTHER;P00021 |
Pathway | Adherens junction;KEGG PATHWAY;hsa04520 |
Pathway | Melanogenesis;KEGG PATHWAY;hsa04916 |
Pathway | Signaling by EGFR;Reactome;REACT:9417 |
Pathway | EPHB forward signaling;PID Curated;200041 |
Pathway | PDGF signaling pathway;PANTHER;P00047 |
Pathway | Signaling by Insulin receptor;Reactome;REACT:498 |
Pathway | aspirin blocks signaling pathway involved in platelet activation;PID BioCarta;100030 |
Pathway | EGF receptor signaling pathway;PANTHER;P00018 |
Pathway | Axon guidance;Reactome;REACT:18266 |
Pathway | regulation of splicing through sam68;PID BioCarta;100036 |
Pathway | IFN-gamma pathway;PID Curated;200110 |
Pathway | Aldosterone-regulated sodium reabsorption;KEGG PATHWAY;hsa04960 |
Pathway | ALK1 signaling events;PID Curated;200126 |
Pathway | Opioid Signalling;Reactome;REACT:15295 |
Pathway | Endothelins;PID Curated;200004 |
Pathway | Progesterone-mediated oocyte maturation;KEGG PATHWAY;hsa04914 |
Pathway | how progesterone initiates the oocyte maturation;PID BioCarta;100104 |
Pathway | erk1/erk2 mapk signaling pathway;PID BioCarta;100170 |
Pathway | Bladder cancer;KEGG PATHWAY;hsa05219 |
Pathway | S1P4 pathway;PID Curated;200043 |
Pathway | Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620 |
Pathway | mcalpain and friends in cell motility;PID BioCarta;100111 |
Pathway | Apoptosis signaling pathway;PANTHER;P00006 |
Pathway | Long-term depression;KEGG PATHWAY;hsa04730 |
Pathway | Oocyte meiosis;KEGG PATHWAY;hsa04114 |
Pathway | ErbB4 signaling events;PID Curated;200009 |
Pathway | TGF-beta signaling pathway;KEGG PATHWAY;hsa04350 |
Pathway | L1CAM interactions;PID Reactome;500097 |
Pathway | role of egf receptor transactivation by gpcrs in cardiac hypertrophy;PID BioCarta;100221 |
Pathway | Syndecan-2-mediated signaling events;PID Curated;200164 |
Pathway | Ras signaling in the CD4+ TCR pathway;PID Curated;200088 |
Pathway | ErbB2/ErbB3 signaling events;PID Curated;200119 |
Pathway | Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161 |
Pathway | influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054 |
Pathway | Interferon-gamma signaling pathway;PANTHER;P00035 |
Pathway | Insulin/IGF pathway-mitogen activated protein kinase kinase/MAP kinase cascade;PANTHER;P00032 |
Pathway | Toxoplasmosis;KEGG PATHWAY;hsa05145 |
Pathway | Signaling events mediated by PRL;PID Curated;200006 |
Pathway | BCR signaling pathway;PID Curated;200005 |
Pathway | Signaling by PDGF;Reactome;REACT:16888 |
Pathway | human cytomegalovirus and map kinase pathways;PID BioCarta;100149 |
Pathway | mapkinase signaling pathway;PID BioCarta;100113 |
Pathway | RSK activation;PID Reactome;500179 |
Pathway | Recycling pathway of L1;PID Reactome;500098 |
Pathway | transcription factor creb and its extracellular signals;PID BioCarta;100198 |
Pathway | Shigellosis;KEGG PATHWAY;hsa05131 |
Pathway | IL2-mediated signaling events;PID Curated;200082 |
Pathway | CXCR3-mediated signaling events;PID Curated;200150 |
Pathway | Colorectal cancer;KEGG PATHWAY;hsa05210 |
Pathway | B cell activation;PANTHER;P00010 |
Pathway | Downstream signaling in naive CD8+ T cells;PID Curated;200184 |
Pathway | Trk receptor signaling mediated by the MAPK pathway;PID Curated;200182 |
Pathway | Prostate cancer;KEGG PATHWAY;hsa05215 |
Pathway | role of beta-arrestins in the activation and targeting of map kinases;PID BioCarta;100229 |
Pathway | Angiogenesis;PANTHER;P00005 |
Pathway | phospholipids as signalling intermediaries;PID BioCarta;100183 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Alzheimer disease-amyloid secretase pathway;PANTHER;P00003 |
Pathway | Melanoma;KEGG PATHWAY;hsa05218 |
Pathway | Glioma;KEGG PATHWAY;hsa05214 |
Pathway | ceramide signaling pathway;PID BioCarta;100206 |
Pathway | T cell receptor signaling pathway;KEGG PATHWAY;hsa04660 |
Pathway | agrin in postsynaptic differentiation;PID BioCarta;100252 |
Pathway | Presenilin action in Notch and Wnt signaling;PID Curated;200052 |
Pathway | melanocyte development and pigmentation pathway;PID BioCarta;100108 |
Pathway | B cell receptor signaling pathway;KEGG PATHWAY;hsa04662 |
Pathway | Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722 |
Pathway | Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810 |
Pathway | S1P3 pathway;PID Curated;200035 |
Pathway | Alpha-synuclein signaling;PID Curated;200187 |
Pathway | trefoil factors initiate mucosal healing;PID BioCarta;100018 |
Pathway | Pancreatic cancer;KEGG PATHWAY;hsa05212 |
Pathway | S1P1 pathway;PID Curated;200071 |
Pathway | NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621 |
Pathway | Axon guidance;KEGG PATHWAY;hsa04360 |
Pathway | Nongenotropic Androgen signaling;PID Curated;200145 |
Pathway | Thyroid cancer;KEGG PATHWAY;hsa05216 |
Pathway | FGF signaling pathway;PID Curated;200189 |
Pathway | Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031 |
Pathway | Signalling by NGF;Reactome;REACT:11061 |
Pathway | CDC42 signaling events;PID Curated;200057 |
Pathway | Chagas disease;KEGG PATHWAY;hsa05142 |
Pathway | ERK2 activation;PID Reactome;500086 |
Pathway | bioactive peptide induced signaling pathway;PID BioCarta;100226 |
Pathway | Long-term potentiation;KEGG PATHWAY;hsa04720 |
Pathway | CREB phophorylation through the activation of Ras;PID Reactome;500177 |
Pathway | keratinocyte differentiation;PID BioCarta;100119 |
Pathway | TRAIL signaling pathway;PID Curated;200056 |
Pathway | S1P2 pathway;PID Curated;200181 |
Pathway | Synaptic Transmission;Reactome;REACT:13685 |
Pathway | angiotensin ii mediated activation of jnk pathway via pyk2 dependent signaling;PID BioCarta;100236 |
Pathway | Netrin-mediated signaling;PID Curated;200074 |
Pathway | mTOR signaling pathway;KEGG PATHWAY;hsa04150 |
Pathway | Renal cell carcinoma;KEGG PATHWAY;hsa05211 |
Pathway | Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664 |
Pathway | Prion diseases;KEGG PATHWAY;hsa05020 |
Pathway | Hemostasis;Reactome;REACT:604 |
Pathway | role of mal in rho-mediated activation of srf;PID BioCarta;100114 |
Pathway | erk and pi-3 kinase are necessary for collagen binding in corneal epithelia;PID BioCarta;100184 |
Pathway | Ceramide signaling pathway;PID Curated;200100 |
Pathway | Syndecan-1-mediated signaling events;PID Curated;200134 |
Pathway | phosphorylation of mek1 by cdk5/p35 down regulates the map kinase pathway;PID BioCarta;100210 |
Pathway | Leishmaniasis;KEGG PATHWAY;hsa05140 |
Pathway | stat3 signaling pathway;PID BioCarta;100028 |
Pathway | Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650 |
Pathway | GMCSF-mediated signaling events;PID Curated;200015 |
Pathway | Vascular smooth muscle contraction;KEGG PATHWAY;hsa04270 |
Pathway | Signaling in Immune system;Reactome;REACT:6900 |
Pathway | Signaling events regulated by Ret tyrosine kinase;PID Curated;200058 |
Pathway | Fc-epsilon receptor I signaling in mast cells;PID Curated;200003 |
Pathway | ErbB1 downstream signaling;PID Curated;200113 |
Pathway | Alzheimer's disease;KEGG PATHWAY;hsa05010 |
Pathway | VEGFR3 signaling in lymphatic endothelium;PID Curated;200188 |
Pathway | Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032 |
Pathway | VEGF signaling pathway;KEGG PATHWAY;hsa04370 |
Pathway | BMP receptor signaling;PID Curated;200123 |
Pathway | Focal adhesion;KEGG PATHWAY;hsa04510 |
Pathway | Chronic myeloid leukemia;KEGG PATHWAY;hsa05220 |
Pathway | Endothelin signaling pathway;PANTHER;P00019 |
Pathway | Osteopontin-mediated events;PID Curated;200042 |
Pathway | T cell activation;PANTHER;P00053 |
Pathway | Neurotrophic factor-mediated Trk receptor signaling;PID Curated;200128 |
Pathway | role of erk5 in neuronal survival pathway;PID BioCarta;100171 |
Pathway | Hepatitis C;KEGG PATHWAY;hsa05160 |
Pathway | Signaling events mediated by focal adhesion kinase;PID Curated;200192 |
Pathway | Dorso-ventral axis formation;KEGG PATHWAY;hsa04320 |
Pathway | Arf6 downstream pathway;PID Curated;200079 |
Pathway | roles of beta arrestin dependent recruitment of src kinases in gpcr signaling;PID BioCarta;100230 |
Pathway | Insulin signaling pathway;KEGG PATHWAY;hsa04910 |
Pathway | Parkinson disease;PANTHER;P00049 |
Pathway | VEGF signaling pathway;PANTHER;P00056 |
Pathway | ErbB signaling pathway;KEGG PATHWAY;hsa04012 |
Pathway | Interleukin signaling pathway;PANTHER;P00036 |
Pathway | links between pyk2 and map kinases;PID BioCarta;100057 |
Pathway | Cellular roles of Anthrax toxin;PID Curated;200179 |
Pathway | Non-small cell lung cancer;KEGG PATHWAY;hsa05223 |
Pathway | Signal transduction by L1;PID Reactome;500100 |
Pathway | fmlp induced chemokine gene expression in hmc-1 cells;PID BioCarta;100162 |
Pathway | GnRH signaling pathway;KEGG PATHWAY;hsa04912 |
Pathway | mTOR signaling pathway;PID Curated;200080 |
Pathway | fc epsilon receptor i signaling in mast cells;PID BioCarta;100165 |
Pathway | Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066 |
Pathway | Gap junction;KEGG PATHWAY;hsa04540 |
Pathway | Regulation of Telomerase;PID Curated;200072 |
Pathway | MAP kinase cascade;BioCyc;PWY66-14 |
Pathway | Integrins in angiogenesis;PID Curated;200109 |
Pathway | Chemokine signaling pathway;KEGG PATHWAY;hsa04062 |
Pathway | cadmium induces dna synthesis and proliferation in macrophages;PID BioCarta;100209 |
Pathway | Type II diabetes mellitus;KEGG PATHWAY;hsa04930 |
Pathway | Ras Pathway;PANTHER;P04393 |
Pathway | regulation of eif-4e and p70s6 kinase;PID BioCarta;100178 |
Pathway | Acute myeloid leukemia;KEGG PATHWAY;hsa05221 |
Disease | alcohol consumption;GAD |
Disease | CHEMDEPENDENCY;GAD |
|
External Links |
|
Links to Entrez Gene | 5594 |
Links to all GeneRIF Items | 5594 |
Links to iHOP | 5594 |
|
Sequence Information |
|
Nucleotide Sequence |
>5594 : length: 1083 atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac gtggggccgcgctacaccaacctctcgtacatcggcgagggcgcctacggcatggtgtgc tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagcccctttgag caccagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacat gagaacatcattggaatcaatgacattattcgagcaccaaccatcgagcaaatgaaagat gtatatatagtacaggacctcatggaaacagatctttacaagctcttgaagacacaacac ctcagcaatgaccatatctgctattttctctaccagatcctcagagggttaaaatatatc cattcagctaacgttctgcaccgtgacctcaagccttccaacctgctgctcaacaccacc tgtgatctcaagatctgtgactttggcctggcccgtgttgcagatccagaccatgatcac acagggttcctgacagaatatgtggccacacgttggtacagggctccagaaattatgttg aattccaagggctacaccaagtccattgatatttggtctgtaggctgcattctggcagaa atgctttctaacaggcccatctttccagggaagcattatcttgaccagctgaaccacatt ttgggtattcttggatccccatcacaagaagacctgaattgtataataaatttaaaagct aggaactatttgctttctcttccacacaaaaataaggtgccatggaacaggctgttccca aatgctgactccaaagctctggacttattggacaaaatgttgacattcaacccacacaag aggattgaagtagaacaggctctggcccacccatatctggagcagtattacgacccgagt gacgagcccatcgccgaagcaccattcaagttcgacatggaattggatgacttgcctaag gaaaagctcaaagaactaatttttgaagagactgctagattccagccaggatacagatct taa |
Protein Sequence |
>5594 : length: 360 MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS |