| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 595 |
Name | CCND1 |
Synonym | BCL1|D11S287E|PRAD1|U21B31;cyclin D1;CCND1;cyclin D1 |
Definition | B-cell CLL/lymphoma 1|B-cell lymphoma 1 protein|BCL-1 oncogene|G1/S-specific cyclin-D1|PRAD1 oncogene |
Position | 11q13 |
Gene Type | protein-coding |
PAH Type | Description |
PAH | "Treatment with recombinant mouse Wnt5a significantly inhibited hypoxia-induced proliferation of human PASMCs, upregulation of Cyclin D1 and beta-catenin expression, as well as the nuclear translocation of beta-catenin". |
| More detail of all Human literatures about CCND1 | |
Pathways and Diseases | |
Pathway | influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054 |
Pathway | il-2 receptor beta chain in t cell activation;PID BioCarta;100129 |
Pathway | Presenilin action in Notch and Wnt signaling;PID Curated;200052 |
Pathway | Cyclin D associated events in G1;PID Reactome;500897 |
Pathway | Small cell lung cancer;KEGG PATHWAY;hsa05222 |
Pathway | Endometrial cancer;KEGG PATHWAY;hsa05213 |
Pathway | ATF-2 transcription factor network;PID Curated;200116 |
Pathway | cell cycle: g1/s check point;PID BioCarta;100160 |
Pathway | FOXM1 transcription factor network;PID Curated;200120 |
Pathway | btg family proteins and cell cycle regulation;PID BioCarta;100224 |
Pathway | Pancreatic cancer;KEGG PATHWAY;hsa05212 |
Pathway | Wnt signaling pathway;KEGG PATHWAY;hsa04310 |
Pathway | Trk receptor signaling mediated by PI3K and PLC-gamma;PID Curated;200183 |
Pathway | inactivation of gsk3 by akt causes accumulation of b-catenin in alveolar macrophages;PID BioCarta;100152 |
Pathway | Regulation of Telomerase;PID Curated;200072 |
Pathway | Focal adhesion;KEGG PATHWAY;hsa04510 |
Pathway | Chronic myeloid leukemia;KEGG PATHWAY;hsa05220 |
Pathway | Neurotrophic factor-mediated Trk receptor signaling;PID Curated;200128 |
Pathway | Bladder cancer;KEGG PATHWAY;hsa05219 |
Pathway | Validated targets of C-MYC transcriptional repression;PID Curated;200171 |
Pathway | PI3 kinase pathway;PANTHER;P00048 |
Pathway | Signaling events mediated by focal adhesion kinase;PID Curated;200192 |
Pathway | Colorectal cancer;KEGG PATHWAY;hsa05210 |
Pathway | Thyroid cancer;KEGG PATHWAY;hsa05216 |
Pathway | Cell Cycle, Mitotic;Reactome;REACT:152 |
Pathway | Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106 |
Pathway | Melanoma;KEGG PATHWAY;hsa05218 |
Pathway | wnt signaling pathway;PID BioCarta;100002 |
Pathway | Wnt signaling pathway;PANTHER;P00057 |
Pathway | p53 signaling pathway;PID BioCarta;100083 |
Pathway | Notch signaling pathway;PID Curated;200013 |
Pathway | Prostate cancer;KEGG PATHWAY;hsa05215 |
Pathway | AP-1 transcription factor network;PID Curated;200118 |
Pathway | Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044 |
Pathway | Non-small cell lung cancer;KEGG PATHWAY;hsa05223 |
Pathway | E-cadherin signaling in the nascent adherens junction;PID Curated;200105 |
Pathway | Cell cycle;KEGG PATHWAY;hsa04110 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Cell cycle;PANTHER;P00013 |
Pathway | Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630 |
Pathway | Glioma;KEGG PATHWAY;hsa05214 |
Pathway | cyclins and cell cycle regulation;PID BioCarta;100207 |
Pathway | Viral myocarditis;KEGG PATHWAY;hsa05416 |
Pathway | Ubiquitin-dependent degradation of Cyclin D1;PID Reactome;501007 |
Pathway | Signaling mediated by p38-gamma and p38-delta;PID Curated;200143 |
Pathway | p53 signaling pathway;KEGG PATHWAY;hsa04115 |
Pathway | Coregulation of Androgen receptor activity;PID Curated;200038 |
Pathway | C-MYB transcription factor network;PID Curated;200130 |
Pathway | Acute myeloid leukemia;KEGG PATHWAY;hsa05221 |
Disease | breast cancer;GAD |
Disease | Osteitis deformans;FunDO |
Disease | kidney cancer;GAD |
Disease | squamous cell carcinoma;GAD |
Disease | cardiac cancer;GAD |
Disease | laryngeal squamous cell carcinoma;GAD |
Disease | Cancer;FunDO |
Disease | Oral cancer;FunDO |
Disease | bladder cancer;GAD |
Disease | esophageal cancer;GAD |
Disease | tumour grade;GAD |
Disease | Neck cancer;FunDO |
Disease | Keratosis;FunDO |
Disease | oral cancer;GAD |
Disease | Multiple myeloma;KEGG DISEASE;H00010 |
Disease | pituitary cancer;GAD |
Disease | cervical cancer;GAD |
Disease | Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE |
Disease | Endemic goiter;FunDO |
Disease | Colorectal cancer, susceptibility to;OMIM |
Disease | prostate cancer;GAD |
Disease | PHARMACOGENOMIC;GAD |
Disease | Cancers of the digestive system;KEGG DISEASE |
Disease | Neoplasms;GAD |
Disease | benzene toxicity;GAD |
Disease | Hyperparathyroidism;FunDO |
Disease | colorectal cancer;GAD |
Disease | Drug abuse;FunDO |
Disease | Breast cancer;KEGG DISEASE;H00031 |
Disease | Hairy-cell leukemia;KEGG DISEASE;H00006 |
Disease | Hamman-Rich syndrome;FunDO |
Disease | gastroesophageal cancer;GAD |
Disease | prostatic hyperplasia;GAD |
Disease | Adenovirus infection;FunDO |
Disease | CANCER;GAD |
Disease | Oral cancer;KEGG DISEASE;H00016 |
Disease | Kidney failure;FunDO |
Disease | squamous cell carcinoma of the head and neck;GAD |
Disease | Laryngeal cancer;KEGG DISEASE;H00055 |
Disease | Cancers of the breast and female genital organs;KEGG DISEASE |
Disease | Endometriosis;FunDO |
Disease | ER negative;GAD |
Disease | colorectal cancer, nonpolyposis;GAD |
Disease | Stomach Neoplasms;GAD |
Disease | urinary bladder cancer;GAD |
Disease | Cancers;KEGG DISEASE |
Disease | lung cancer smoking behavior;GAD |
Disease | bladder cancer, urinary;GAD |
Disease | gastric cardiac cancer;GAD |
Disease | liver cancer;GAD |
Disease | lymphocytic lymphoma of intermediate differentiation;GAD |
Disease | stomach cancer;GAD |
Disease | Obesity;FunDO |
Disease | Congenital abnormality;FunDO |
Disease | von Hippel-Lindau disease, modification of;OMIM |
Disease | endometrial cancer;GAD |
Disease | Head and neck cancers;KEGG DISEASE |
Disease | advanced colorectal cancer;GAD |
Disease | Esophageal cancer;KEGG DISEASE;H00017 |
External Links | |
Links to Entrez Gene | 595 |
Links to all GeneRIF Items | 595 |
Links to iHOP | 595 |
Sequence Information | |
Nucleotide Sequence | >595 : length: 888 atggaacaccagctcctgtgctgcgaagtggaaaccatccgccgcgcgtaccccgatgcc aacctcctcaacgaccgggtgctgcgggccatgctgaaggcggaggagacctgcgcgccc tcggtgtcctacttcaaatgtgtgcagaaggaggtcctgccgtccatgcggaagatcgtc gccacctggatgctggaggtctgcgaggaacagaagtgcgaggaggaggtcttcccgctg gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag ctgctgggggccacttgcatgttcgtggcctctaagatgaaggagaccatccccctgacg gccgagaagctgtgcatctacaccgacaactccatccggcccgaggagctgctgcaaatg gagctgctcctggtgaacaagctcaagtggaacctggccgcaatgaccccgcacgatttc attgaacacttcctctccaaaatgccagaggcggaggagaacaaacagatcatccgcaaa cacgcgcagaccttcgttgccctctgtgccacagatgtgaagttcatttccaatccgccc tccatggtggcagcggggagcgtggtggccgcagtgcaaggcctgaacctgaggagcccc aacaacttcctgtcctactaccgcctcacacgcttcctctccagagtgatcaagtgtgac ccggactgcctccgggcctgccaggagcagatcgaagccctgctggagtcaagcctgcgc caggcccagcagaacatggaccccaaggccgccgaggaggaggaagaggaggaggaggag gtggacctggcttgcacacccaccgacgtgcgggacgtggacatctga |
Protein Sequence | >595 : length: 295 MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI |