| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 6347 |
Name | CCL2 |
Synonym | GDCF-2|HC11|HSMCR30|MCAF|MCP-1|MCP1|SCYA2|SMC-CF;chemokine (C-C motif) ligand 2;CCL2;chemokine (C-C motif) ligand 2 |
Definition | C-C motif chemokine 2|monocyte chemoattractant protein 1|monocyte chemoattractant protein-1|monocyte chemotactic and activating factor|monocyte chemotactic protein 1|monocyte secretory protein JE|small inducible cytokine A2 (monocyte chemotactic protein 1 |
Position | 17q11.2-q12 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PH | Supplemental Table 1: A list of genes and functional categories that comprises a PHrelevant gene module (PH-module). |
| More detail of all Human literatures about CCL2 | |
|
Pathways and Diseases |
|
Pathway | Chagas disease;KEGG PATHWAY;hsa05142 |
Pathway | pertussis toxin-insensitive ccr5 signaling in macrophage;PID BioCarta;100214 |
Pathway | Malaria;KEGG PATHWAY;hsa05144 |
Pathway | Signaling by GPCR;Reactome;REACT:14797 |
Pathway | NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621 |
Pathway | IL23-mediated signaling events;PID Curated;200131 |
Pathway | Chemokine signaling pathway;KEGG PATHWAY;hsa04062 |
Pathway | Diabetes pathways;Reactome;REACT:15380 |
Pathway | AP-1 transcription factor network;PID Curated;200118 |
Pathway | Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044 |
Pathway | GMCSF-mediated signaling events;PID Curated;200015 |
Pathway | Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Disease | Chagas Disease;GAD |
Disease | Growth retardation;FunDO |
Disease | Nasopharyngeal cancer;FunDO |
Disease | Down syndrome;FunDO |
Disease | Depression;FunDO |
Disease | Bronchiolitis;FunDO |
Disease | Influenza;FunDO |
Disease | IMMUNE;GAD |
Disease | Alopecia;FunDO |
Disease | INFECTION;GAD |
Disease | Penile disease;FunDO |
Disease | Asthma. asthma severity;GAD |
Disease | Hyperhomocysteinemia;FunDO |
Disease | Lupus vulgaris;FunDO |
Disease | renal tubular damage;GAD |
Disease | Infertility;FunDO |
Disease | myocardial infarct;GAD |
Disease | Intractable epilepsy;FunDO |
Disease | Peptic esophagitis;FunDO |
Disease | Neuroblastoma;FunDO |
Disease | Mycobacterium infection, Atypical;FunDO |
Disease | Melanoma;FunDO |
Disease | Liver cancer;FunDO |
Disease | Mycobacterium tuberculosis, susceptibility to;OMIM |
Disease | intima-media thickness;GAD |
Disease | Hypercholesterolemia;FunDO |
Disease | Pancreatitis;FunDO |
Disease | sclerosis, systemic;GAD |
Disease | diabetes, type 2 metabolic syndrome;GAD |
Disease | HIV;GAD |
Disease | Nephritis;FunDO |
Disease | Hyperinsulinism;FunDO |
Disease | Crohn's disease;GAD |
Disease | Hepatitis C, Chronic;GAD |
Disease | Brain tumor;FunDO |
Disease | Bipolar disorder;FunDO |
Disease | Squamous cell cancer;FunDO |
Disease | IGA glomerulonephritis;FunDO |
Disease | atherosclerosis, carotid;GAD |
Disease | Atherosclerosis;FunDO |
Disease | Arthritis;FunDO |
Disease | Macular degeneration;FunDO |
Disease | Edema rosiglitazone or pioglitazone;GAD |
Disease | HIV infection;FunDO |
Disease | Esophagus cancer;FunDO |
Disease | Pleural effusion, Malignant;FunDO |
Disease | Prostate cancer;FunDO |
Disease | Spina bifida, susceptibility to;OMIM |
Disease | pancreatitis, chronic;GAD |
Disease | Leukemia;FunDO |
Disease | PHARMACOGENOMIC;GAD |
Disease | METABOLIC;GAD |
Disease | Schizophrenia;FunDO |
Disease | systemic lupus erythematosus;GAD |
Disease | tuberculosis;GAD |
Disease | diabetes, type 2;GAD |
Disease | Tuberculosis;FunDO |
Disease | Coronary Artery Disease;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | Labor, Premature;FunDO |
Disease | CNS metastases;FunDO |
Disease | Hepatitis B;FunDO |
Disease | Tuberous sclerosis;FunDO |
Disease | Obesity;FunDO |
Disease | Lipodystrophy;FunDO |
Disease | Epstein-Barr virus infection;FunDO |
Disease | Hepatitis C;FunDO |
Disease | Hepatitis B, Chronic;GAD |
Disease | HIV-1, resistance to;OMIM |
Disease | Stomach cancer;FunDO |
Disease | Amyotrophic lateral sclerosis;FunDO |
Disease | Dementia;GAD |
Disease | nephropathy in other diseases;GAD |
Disease | Systemic scleroderma;FunDO |
Disease | glucose insulin;GAD |
Disease | Pulmonary fibrosis;FunDO |
Disease | Liver disease;FunDO |
Disease | Asthma;GAD |
Disease | Proteinuria;FunDO |
Disease | Alzheimer's disease;FunDO |
Disease | Autoimmune disease;FunDO |
Disease | carpal-tunnel syndrome;GAD |
Disease | bone density;GAD |
Disease | Coronary artery disease, modifier of;OMIM |
Disease | Diabetes mellitus;FunDO |
Disease | Hemorrhagic fevers, Viral;FunDO |
Disease | Kidney failure;FunDO |
Disease | Endometriosis;FunDO |
Disease | NEUROLOGICAL;GAD |
Disease | Hypothyroidism;FunDO |
Disease | Heart failure;FunDO |
Disease | Lyme disease;FunDO |
|
External Links |
|
Links to Entrez Gene | 6347 |
Links to all GeneRIF Items | 6347 |
Links to iHOP | 6347 |
|
Sequence Information |
|
Nucleotide Sequence |
>6347 : length: 300 atgaaagtctctgccgcccttctgtgcctgctgctcatagcagccaccttcattccccaa gggctcgctcagccagatgcaatcaatgccccagtcacctgctgttataacttcaccaat aggaagatctcagtgcagaggctcgcgagctatagaagaatcaccagcagcaagtgtccc aaagaagctgtgatcttcaagaccattgtggccaaggagatctgtgctgaccccaagcag aagtgggttcaggattccatggaccacctggacaagcaaacccaaactccgaagacttga |
Protein Sequence |
>6347 : length: 99 MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT |