| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 6348 |
Name | CCL3 |
Synonym | G0S19-1|LD78ALPHA|MIP-1-alpha|MIP1A|SCYA3;chemokine (C-C motif) ligand 3;CCL3;chemokine (C-C motif) ligand 3 |
Definition | C-C motif chemokine 3|G0/G1 switch regulatory protein 19-1|PAT 464.1|SIS-beta|macrophage inflammatory protein 1-alpha|small inducible cytokine A3 (homologous to mouse Mip-1a)|tonsillar lymphocyte LD78 alpha protein |
Position | 17q12 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PH | Supplemental Table 1: A list of genes and functional categories that comprises a PHrelevant gene module (PH-module). |
| More detail of all Human literatures about CCL3 | |
|
Pathways and Diseases |
|
Pathway | Chagas disease;KEGG PATHWAY;hsa05142 |
Pathway | Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620 |
Pathway | Signaling by GPCR;Reactome;REACT:14797 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | Chemokine signaling pathway;KEGG PATHWAY;hsa04062 |
Pathway | IL12-mediated signaling events;PID Curated;200034 |
Pathway | Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031 |
Disease | Encephalitis;FunDO |
Disease | Neoplasm metastasis;FunDO |
Disease | Squamous cell cancer;FunDO |
Disease | Influenza;FunDO |
Disease | Cystic fibrosis;FunDO |
Disease | Multiple myeloma;FunDO |
Disease | Rheumatoid arthritis;FunDO |
Disease | HIV infection, resistance to;OMIM |
Disease | Leukemia;FunDO |
Disease | Familial Mediterranean fever;FunDO |
Disease | Schistosoma mansonii infection;FunDO |
Disease | Alveolar bone loss;FunDO |
Disease | Sarcoidosis;FunDO |
Disease | Tuberculosis;FunDO |
Disease | Breast cancer;FunDO |
Disease | HIV infection;FunDO |
Disease | Alzheimer's disease;FunDO |
Disease | Liver cancer;FunDO |
Disease | Bronchiolitis;FunDO |
|
External Links |
|
Links to Entrez Gene | 6348 |
Links to all GeneRIF Items | 6348 |
Links to iHOP | 6348 |
|
Sequence Information |
|
Nucleotide Sequence |
>6348 : length: 279 atgcaggtctccactgctgcccttgctgtcctcctctgcaccatggctctctgcaaccag ttctctgcatcacttgctgctgacacgccgaccgcctgctgcttcagctacacctcccgg cagattccacagaatttcatagctgactactttgagacgagcagccagtgctccaagccc ggtgtcatcttcctaaccaagcgaagccggcaggtctgtgctgaccccagtgaggagtgg gtccagaaatatgtcagcgacctggagctgagtgcctga |
Protein Sequence |
>6348 : length: 92 MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKP GVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |