General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information |
|
---|---|
Gene ID | 6532 |
Name | SLC6A4 |
Synonym | 5-HTT|5-HTTLPR|5HTT|HTT|OCD1|SERT|SERT1|hSERT;solute carrier family 6 (neurotransmitter transporter, serotonin), member 4;SLC6A4;solute carrier family 6 (neurotransmitter transporter, serotonin), member 4 |
Definition | 5-hydroxytryptamine transporter|5HT transporter|Na+/Cl- dependent serotonin transporter|sodium-dependent serotonin transporter |
Position | 17q11.2 |
Gene Type | protein-coding |
PAH Type |
Description |
HPH | Attenuated hypoxic pulmonary hypertension in mice lacking the 5-hydroxytryptamine transporter gene. |
PAH | Polymorphism of the serotonin transporter gene and pulmonary hypertension in chronic obstructive pulmonary disease. |
PAH | Serotonin-induced smooth muscle hyperplasia in various forms of human pulmonary hypertension. |
PAH | Allelic variation in the serotonin transporter (5HTT) gene contributes to idiopathic pulmonary hypertension in children. |
PAH | Genetic association of the serotonin transporter in pulmonary arterial hypertension. |
PAH | Transgenic mice overexpressing the 5-hydroxytryptamine transporter gene in smooth muscle develop pulmonary hypertension. |
PAH | Repeat length polymorphism of the serotonin transporter gene influences pulmonary artery pressure in heart failure. |
PAH | "Genetic polymorphisms of the serotonin transporter, but not the 2a receptor or nitric oxide synthetase, are associated with pulmonary hypertension in chronic obstructive pulmonary disease." |
PAH | Sequence variants in BMPR2 and genes involved in the serotonin and nitric oxide pathways in idiopathic pulmonary arterial hypertension and chronic thromboembolic pulmonary hypertension: relation to clinical parameters and comparison with left heart disease. |
PAH | Association study of serotonin transporter gene polymorphisms and ventricular septal defects related possible pulmonary arterial hypertension in Chinese population. |
More detail of all Mouse literatures about SLC6A4 | |
Pathways and Diseases |
|
Pathway | 5HT2 type receptor mediated signaling pathway;PANTHER;P04374 |
Pathway | 5HT3 type receptor mediated signaling pathway;PANTHER;P04375 |
Pathway | 5HT1 type receptor mediated signaling pathway;PANTHER;P04373 |
Pathway | 5HT4 type receptor mediated signaling pathway;PANTHER;P04376 |
Disease | ADHD;GAD |
Disease | major depression;GAD |
Disease | obsessive-compulsive disorder;GAD |
Disease | decision making;GAD |
Disease | depression depressive disorder, major;GAD |
Disease | aggressive behavior;GAD |
Disease | Depression;FunDO |
Disease | Hypertension, Pulmonary;FunDO |
Disease | personality disorders;GAD |
Disease | anorexia nervosa;GAD |
Disease | Sudden infant death syndrome;FunDO |
Disease | IMMUNE;GAD |
Disease | Parkinson's disease;GAD |
Disease | depressive disorder, major;GAD |
Disease | Colon cancer;FunDO |
Disease | mood disorders;GAD |
Disease | PSYCH;GAD |
Disease | chronic obstructive pulmonary disease;GAD |
Disease | personality traits;GAD |
Disease | Psychotic disorder;FunDO |
Disease | Anxiety-related personality traits;OMIM |
Disease | decision-making memory impairment;GAD |
Disease | affective disorder;GAD |
Disease | chronic fatigue syndrome;GAD |
Disease | serotonin;GAD |
Disease | major and bipolar depressives;GAD |
Disease | brain function;GAD |
Disease | mania, antidepressant-induced;GAD |
Disease | alcohol use;GAD |
Disease | unipolar disorder;GAD |
Disease | smoking;GAD |
Disease | temporomandibular joint pain;GAD |
Disease | substance abuse;GAD |
Disease | anxiety disorders;GAD |
Disease | Atherosclerosis;FunDO |
Disease | Obsessive-compulsive disorder 1;OMIM |
Disease | Irritable Bowel Syndrome;GAD |
Disease | psychosis, alcoholic;GAD |
Disease | Migraine;FunDO |
Disease | severe hyperkinetic disorders;GAD |
Disease | brain electrical response;GAD |
Disease | Ulcerative colitis;FunDO |
Disease | bipolar affective disorder;GAD |
Disease | Herpes;FunDO |
Disease | adverse neonatal outcomes birth weight neuromotor symptoms respiratory distress syndrome, neonatal;GAD |
Disease | sleep disorders;GAD |
Disease | stroke, ischemic;GAD |
Disease | Dermatitis;FunDO |
Disease | Sexual Dysfunction, Physiological;GAD |
Disease | anxiety-related traits;GAD |
Disease | bipolar and unipolar disorder;GAD |
Disease | eating disorder;GAD |
Disease | Drug abuse;FunDO |
Disease | Panic disorder;FunDO |
Disease | psychoses;GAD |
Disease | suicide;GAD |
Disease | anxiety disorder migraine;GAD |
Disease | suicide family history;GAD |
Disease | attention deficit hyperactivity disorder;GAD |
Disease | Bipolar disorder;FunDO |
Disease | harm avoidance behaviour in an elderly population.;GAD |
Disease | Anxiety and hostility and depression;GAD |
Disease | schizophrenia;GAD |
Disease | chronic obstructive pulmonary disease/COPD;GAD |
Disease | Obsessive-compulsive disorder;FunDO |
Disease | body mass bulimia harm avoidance personality disorders;GAD |
Disease | Autism;GAD |
Disease | bipolar disorder;GAD |
Disease | anxiety-related temperament and behavior problems;GAD |
Disease | aggression;GAD |
Disease | mood response;GAD |
Disease | Pervasive development disorder;FunDO |
Disease | AGING;GAD |
Disease | loudness dependence;GAD |
Disease | auditory evoked potential;GAD |
Disease | conduct disorder;GAD |
Disease | violent suicidal behavior;GAD |
Disease | Chronic fatigue syndrome;FunDO |
Disease | alcohol abuse;GAD |
Disease | PHARMACOGENOMIC;GAD |
Disease | panic disorder;GAD |
Disease | anxiety symptoms;GAD |
Disease | METABOLIC;GAD |
Disease | alcoholism;GAD |
Disease | Autistic disorder;FunDO |
Disease | diabetes, type 2;GAD |
Disease | pathological gambling;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | cardiovascular;GAD |
Disease | Generalized anxiety disorder;FunDO |
Disease | Fibromyalgia;FunDO |
Disease | anorexia nervosa and food intake;GAD |
Disease | illegal drug use;GAD |
Disease | Chronic obstructive airway disease;FunDO |
Disease | REPRODUCTION;GAD |
Disease | impulse control disorder;GAD |
Disease | alcohol abuse substance abuse;GAD |
Disease | Obesity;FunDO |
Disease | Anorexia nervosa;FunDO |
Disease | alcohol intake;GAD |
Disease | Anxiety traits;GAD |
Disease | migraine with aura;GAD |
Disease | anxiety disorder;GAD |
Disease | Neurotic disorder;FunDO |
Disease | introversion and neuroticism;GAD |
Disease | depression;GAD |
Disease | Congenital heart disease;FunDO |
Disease | obesity;GAD |
Disease | delirium tremens;GAD |
Disease | migraine;GAD |
Disease | gastrointestinal disorders;GAD |
Disease | schizotypal traits;GAD |
Disease | SIDS/sudden infant death syndrome;GAD |
Disease | Dementia;GAD |
Disease | Depression, Postpartum;GAD |
Disease | obsessive compulsive disorder;GAD |
Disease | hyperkinetic disorder;GAD |
Disease | Pulmonary hypertension;FunDO |
Disease | Stroke;FunDO |
Disease | cognitive ability;GAD |
Disease | Epilepsy;FunDO |
Disease | dance performance;GAD |
Disease | suicide, alcohol-dependent;GAD |
Disease | agreeableness;GAD |
Disease | CHEMDEPENDENCY;GAD |
Disease | neuroticism;GAD |
Disease | Behavior disease;FunDO |
Disease | Myocardial Infarction;GAD |
Disease | Weight Loss;GAD |
Disease | NEUROLOGICAL;GAD |
Disease | citalopram adverse effects depressive disorder, major;GAD |
Disease | attention-deficit hyperactivity disorder;GAD |
Disease | Heart failure;FunDO |
Disease | affective psychoses;GAD |
Disease | auditory-evoked potentials;GAD |
Disease | Fibromyalgia;GAD |
Disease | violent suicide;GAD |
Disease | suicidal behavior;GAD |
Disease | mood disorder;GAD |
External Links |
|
Links to Entrez Gene | 6532 |
Links to all GeneRIF Items | 6532 |
Links to iHOP | 6532 |
Sequence Information |
|
Nucleotide Sequence |
>6532 : length: 1893 atggagacgacgcccttgaattctcagaagcagctatcagcgtgtgaagatggagaagat tgtcaggaaaacggagttctacagaaggttgttcccaccccaggggacaaagtggagtcc gggcaaatatccaatgggtactcagcagttccaagtcctggtgcgggagatgacacacgg cactctatcccagcgaccaccaccaccctagtggctgagcttcatcaaggggaacgggag acctggggcaagaaggtggatttccttctctcagtgattggctatgctgtggacctgggc aatgtctggcgcttcccctacatatgttaccagaatggagggggggcattcctcctcccc tacaccatcatggccatttttgggggaatcccgctcttttacatggagctcgcactggga cagtaccaccgaaatggatgcatttcaatatggaggaaaatctgcccgattttcaaaggg attggttatgccatctgcatcattgccttttacattgcttcctactacaacaccatcatg gcctgggcgctatactacctcatctcctccttcacggaccagctgccctggaccagctgc aagaactcctggaacactggcaactgcaccaattacttctccgaggacaacatcacctgg accctccattccacgtcccctgctgaagaattttacacgcgccacgtcctgcagatccac cggtctaaggggctccaggacctggggggcatcagctggcagctggccctctgcatcatg ctgatcttcactgttatctacttcagcatctggaaaggcgtcaagacctctggcaaggtg gtgtgggtgacagccaccttcccttatatcatcctttctgtcctgctggtgaggggtgcc accctccctggagcctggaggggtgttctcttctacttgaaacccaattggcagaaactc ctggagacaggggtgtggatagatgcagccgctcagatcttcttctctcttggtccgggc tttggggtcctgctggcttttgctagctacaacaagttcaacaacaactgctaccaagat gccctggtgaccagcgtggtgaactgcatgacgagcttcgtttcgggatttgtcatcttc acagtgctcggttacatggctgagatgaggaatgaagatgtgtctgaggtggccaaagac gcaggtcccagcctcctcttcatcacgtatgcagaagcgatagccaacatgccagcgtcc actttctttgccatcatcttctttctgatgttaatcacgctgggcttggacagcacgttt gcaggcttggagggggtgatcacggctgtgctggatgagttcccacacgtctgggccaag cgccgggagcggttcgtgctcgccgtggtcatcacctgcttctttggatccctggtcacc ctgacttttggaggggcctacgtggtgaagctgctggaggagtatgccacggggcccgca gtgctcactgtcgcgctgatcgaagcagtcgctgtgtcttggttctatggcatcactcag ttctgcagggacgtgaaggaaatgctcggcttcagcccggggtggttctggaggatctgc tgggtggccatcagccctctgtttctcctgttcatcatttgcagttttctgatgagcccg ccacaactacgacttttccaatataattatccttactggagtatcatcttgggttactgc ataggaacctcatctttcatttgcatccccacatatatagcttatcggttgatcatcact ccagggacatttaaagagcgtattattaaaagtattaccccagaaacaccaacagaaatt ccttgtggggacatccgcttgaatgctgtgtaa |
Protein Sequence |
>6532 : length: 630 METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTR HSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLP YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIM AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIH RSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGA TLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVT LTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRIC WVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIIT PGTFKERIIKSITPETPTEIPCGDIRLNAV |