| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 6696 |
Name | SPP1 |
Synonym | BNSP|BSPI|ETA-1|OPN;secreted phosphoprotein 1;SPP1;secreted phosphoprotein 1 |
Definition | SPP1/CALPHA1 fusion|early T-lymphocyte activation 1|nephropontin|osteopontin|osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein|secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1)|urinar |
Position | 4q22.1 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | "Circulating OPN predicts survival in patients with IPAH and is associated with a higher New York Heart Association class. OPN, thus, may be useful as a biomarker in IPAH." |
PAH | "Circulating OPN predicts survival in patients with IPAH and is associated with a higher New York Heart Association class. OPN, thus, may be useful as a biomarker in IPAH." |
| More detail of all Human literatures about SPP1 | |
|
Pathways and Diseases |
|
Pathway | Signaling by PDGF;Reactome;REACT:16888 |
Pathway | Focal adhesion;KEGG PATHWAY;hsa04510 |
Pathway | Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620 |
Pathway | Integrins in angiogenesis;PID Curated;200109 |
Pathway | Integrin cell surface interactions;PID Reactome;500004 |
Pathway | Direct p53 effectors;PID Curated;200101 |
Pathway | Osteopontin-mediated events;PID Curated;200042 |
Pathway | regulators of bone mineralization;PID BioCarta;100089 |
Pathway | ECM-receptor interaction;KEGG PATHWAY;hsa04512 |
Pathway | Integrin cell surface interactions;Reactome;REACT:13552 |
Pathway | FGF signaling pathway;PID Curated;200189 |
Disease | Lupus erythematosus;FunDO |
Disease | Biliary Atresia;FunDO |
Disease | pseudoxanthoma elasticum;GAD |
Disease | Hepatitis C;FunDO |
Disease | Cancer;FunDO |
Disease | Eating disorder;FunDO |
Disease | HIV infection;FunDO |
Disease | Ulcerative colitis;FunDO |
Disease | Parkinson disease;FunDO |
Disease | intima-media thickness;GAD |
Disease | Herpes;FunDO |
Disease | Pancreatitis;FunDO |
Disease | IMMUNE;GAD |
Disease | Rheumatoid arthritis;FunDO |
Disease | Inflammation of the central nervous system;FunDO |
Disease | rheumatoid arthritis;GAD |
Disease | systemic lupus erythematosus;GAD |
Disease | Nephrolithiasis;GAD |
Disease | Dental plaque;FunDO |
Disease | METABOLIC;GAD |
Disease | Diabetes mellitus;FunDO |
Disease | asthma IgE;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | Multiple sclerosis;FunDO |
Disease | CANCER;GAD |
Disease | Carotid Artery Diseases;GAD |
Disease | Kidney failure;FunDO |
Disease | hepatitis B liver cancer;GAD |
Disease | Heart failure;FunDO |
Disease | Enteritis;FunDO |
Disease | Osteoporosis;FunDO |
Disease | Lupus vulgaris;FunDO |
Disease | Obesity;FunDO |
Disease | Atherosclerosis;FunDO |
|
External Links |
|
Links to Entrez Gene | 6696 |
Links to all GeneRIF Items | 6696 |
Links to iHOP | 6696 |
|
Sequence Information |
|
Nucleotide Sequence |
>6696 : length: 903 atgagaattgcagtgatttgcttttgcctcctaggcatcacctgtgccataccagttaaa caggctgattctggaagttctgaggaaaagcagctttacaacaaatacccagatgctgtg gccacatggctaaaccctgacccatctcagaagcagaatctcctagccccacagaccctt ccaagtaagtccaacgaaagccatgaccacatggatgatatggatgatgaagatgatgat gaccatgtggacagccaggactccattgactcgaacgactctgatgatgtagatgacact gatgattctcaccagtctgatgagtctcaccattctgatgaatctgatgaactggtcact gattttcccacggacctgccagcaaccgaagttttcactccagttgtccccacagtagac acatatgatggccgaggtgatagtgtggtttatggactgaggtcaaaatctaagaagttt cgcagacctgacatccagtaccctgatgctacagacgaggacatcacctcacacatggaa agcgaggagttgaatggtgcatacaaggccatccccgttgcccaggacctgaacgcgcct tctgattgggacagccgtgggaaggacagttatgaaacgagtcagctggatgaccagagt gctgaaacccacagccacaagcagtccagattatataagcggaaagccaatgatgagagc aatgagcattccgatgtgattgatagtcaggaactttccaaagtcagccgtgaattccac agccatgaatttcacagccatgaagatatgctggttgtagaccccaaaagtaaggaagaa gataaacacctgaaatttcgtatttctcatgaattagatagtgcatcttctgaggtcaat taa |
Protein Sequence |
>6696 : length: 300 MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQTL PSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVT DFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDITSHME SEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDES NEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN |